3cw1

Crystal Structure of Human Spliceosomal U1 snRNP

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small nuclear ribonucleoprotein Sm D3

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–126； UniProt 1–126 Author chain S； PDBConstruct 1–126； UniProt 1–126 Author chain T； PDBConstruct 1–126； UniProt 1–126 Author chain U； PDBConstruct 1–126； UniProt 1–126

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

Homo sapiens

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–174； UniProt 1–174 Author chain H； PDBConstruct 1–174； UniProt 1–174 Author chain I； PDBConstruct 1–174； UniProt 1–174 Author chain J； PDBConstruct 1–174； UniProt 1–174

Small nuclear ribonucleoprotein Sm D1

Homo sapiens

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–119； UniProt 1–119 Author chain M； PDBConstruct 1–119； UniProt 1–119 Author chain N； PDBConstruct 1–119； UniProt 1–119 Author chain O； PDBConstruct 1–119； UniProt 1–119

Small nuclear ribonucleoprotein Sm D2

Homo sapiens

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C； PDBConstruct 1–118； UniProt 1–118 Author chain P； PDBConstruct 1–118； UniProt 1–118 Author chain Q； PDBConstruct 1–118； UniProt 1–118 Author chain R； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein F

Homo sapiens

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 1； PDBConstruct 1–86； UniProt 1–86 Author chain 2； PDBConstruct 1–86； UniProt 1–86 Author chain F； PDBConstruct 1–86； UniProt 1–86 Author chain Z； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein E

Homo sapiens

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E； PDBConstruct 1–92； UniProt 1–92 Author chain W； PDBConstruct 1–92； UniProt 1–92 Author chain X； PDBConstruct 1–92； UniProt 1–92 Author chain Y； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein G

Homo sapiens

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 3； PDBConstruct 1–76； UniProt 1–76 Author chain 4； PDBConstruct 1–76； UniProt 1–76 Author chain 5； PDBConstruct 1–76； UniProt 1–76 Author chain G； PDBConstruct 1–76； UniProt 1–76

U1 small nuclear ribonucleoprotein 70 kDa

Homo sapiens

UniProt P08621

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein C × 1 （P09234） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU17_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 6； PDBConstruct 1–216； UniProt 1–216 Author chain 7； PDBConstruct 1–216； UniProt 1–216 Author chain 8； PDBConstruct 1–216； UniProt 1–216 Author chain K； PDBConstruct 1–216； UniProt 1–216

U1 small nuclear ribonucleoprotein C

Homo sapiens

UniProt P09234

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） ZINC ION × 1	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） ZINC ION × 1	Consistent with all polymers
3	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） ZINC ION × 1	Consistent with all polymers
4	Protein–RNA	Heteromer	Protein 9 RNA 1	U1 snRNA × 1 Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 1 （P14678） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU1C_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 0； PDBConstruct 1–77； UniProt 1–77 Author chain 9； PDBConstruct 1–77； UniProt 1–77 Author chain L； PDBConstruct 1–77； UniProt 1–77 Author chain l； PDBConstruct 1–77； UniProt 1–77

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3cw1
Deposition date deposition_date	2008-04-21
Structure title title	Crystal Structure of Human Spliceosomal U1 snRNP
Keywords keywords	;pre-mRNA splicing, spliceosome, RNA-binding domain, Sm fold, zinc finger, RNA recognition motif, 5' splice site, SPLICING ;; SPLICING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3cw1__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3cw1__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3cw1__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.07 Å
Rg (electron density)	37.88 Å
Total Rg	37.91 Å
Atom count	139
Residues	138
Excluded volume	100450 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3cw1__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3cw1__assembly_2__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3cw1__assembly_3__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3cw1__assembly_4__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	U1 snRNA
Molecular weight formula_weight	44418.2 kDa
Mutation mutation	C53G,G54A,A55G,G56A,U83C,A85U
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	V,v,w,x
Atom count atom_count	3365

AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGGAGACGUCCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCCCCUG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606

Entity 2 Entity 2 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13956.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,S,T,U

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGCKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	18004.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,H,I,J

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M,N,O

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P,Q,R

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Z,1,2

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,W,X,Y

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,3,4,5

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	U1 small nuclear ribonucleoprotein 70 kDa
Molecular weight formula_weight	25372.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,6,7,8

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	U1 small nuclear ribonucleoprotein C
Molecular weight formula_weight	8800.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,9,0,l

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYCKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

▶

7. Citations (7)

Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.

Nature (2009)

PMID: 19325628 · DOI: 10.1038/nature07851 PRIMARY

Structure of the spliceosomal U4 snRNP core domain and its implication for snRNP biogenesis

Nature (2011)

PMID: 21516107 · DOI: 10.1038/nature09956

The structure and biochemical properties of the human spliceosomal protein U1C.

J.Mol.Biol. (2004)

PMID: 15312772 · DOI: 10.1016/j.jmb.2004.04.078

A retroviral RNA kissing complex containing only two G.C base pairs.

Proc.Natl.Acad.Sci.USA (2000)

PMID: 10931958 · DOI: 10.1073/pnas.170283697

Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs.

Cell(Cambridge,Mass.) (1999)

PMID: 10025403

Crystal structure at 1.92 A resolution of the RNA-binding domain of the U1A spliceosomal protein complexed with an RNA hairpin.

Nature (1994)

PMID: 7984237 · DOI: 10.1038/372432a0

Solution structure of human U1 snRNA. Derivation of a possible three-dimensional model.

Nucleic Acids Res. (1990)

PMID: 2374709

Unit-cell length a length_a	126.471 Å
Unit-cell length b length_b	127.075 Å
Unit-cell length c length_c	152.024 Å
Unit-cell angle α angle_alpha	95.42 °
Unit-cell angle β angle_beta	105.92 °
Unit-cell angle γ angle_gamma	101.80 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.493 Å
Low-resolution limit resolution_low	123.091 Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Crystal Structure of Human Spliceosomal U1 snRNP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Small nuclear ribonucleoprotein Sm D3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein Sm D2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Small nuclear ribonucleoprotein G

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein 70 kDa

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U1 small nuclear ribonucleoprotein C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cw1__assembly_2__model_1

3cw1__assembly_2__model_1 | I(q)

3cw1__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment