SAXSdb — 3dcq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fucose-binding lectin PA-IIL

Pseudomonas aeruginosa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	CALCIUM ION × 8 ;(2S)-1-[(2S)-6-amino-2-({[(2S,3S,4R,5S,6S)-3,4,5-trihydroxy-6-methyltetrahydro-2H-pyran-2-yl]acetyl}amino)hexanoyl]-N-[(1S)-1-carbamoyl-3-methylbutyl]pyrrolidine-2-carboxamide ; × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HYN5_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–114； UniProt 2–115 Author chain B； PDBConstruct 1–114； UniProt 2–115 Author chain C； PDBConstruct 1–114； UniProt 2–115 Author chain D； PDBConstruct 1–114； UniProt 2–115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3dcq
Deposition date deposition_date	2008-06-04
Structure title title	LECB (PA-LII) in complex with the synthetic ligand 2G0
Keywords keywords	LECTIN, CARBOHYDRATE, SUGAR BINDING PROTEIN; SUGAR BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3dcq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3dcq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3dcq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.26 Å
Rg (electron density)	20.88 Å
Total Rg	21.74 Å
Atom count	3367
Residues	456
Excluded volume	59319 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3dcq__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fucose-binding lectin PA-IIL
Molecular weight formula_weight	11734.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3743

ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 non-polymer

Description description	;(2S)-1-[(2S)-6-amino-2-({[(2S,3S,4R,5S,6S)-3,4,5-trihydroxy-6-methyltetrahydro-2H-pyran-2-yl]acetyl}amino)hexanoyl]-N-[(1S)-1-carbamoyl-3-methylbutyl]pyrrolidine-2-carboxamide ;
Molecular weight formula_weight	543.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	340

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3dcqa_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

Domain ID domain_id	d3dcqb_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

Domain ID domain_id	d3dcqc_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

Domain ID domain_id	d3dcqd_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

CATH v4.4 (4 domains)

Domain ID domain_id	3dcqA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

Domain ID domain_id	3dcqB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

Domain ID domain_id	3dcqC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

Domain ID domain_id	3dcqD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

▶

Unit-cell length a length_a	51.320 Å
Unit-cell length b length_b	75.520 Å
Unit-cell length c length_c	99.030 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1780
R_work r_work	0.1763
R_free r_free	0.2108

LECB (PA-LII) in complex with the synthetic ligand 2G0

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fucose-binding lectin PA-IIL

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dcq__assembly_1__model_1

3dcq__assembly_1__model_1 | I(q)

3dcq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

LECB (PA-LII) in complex with the synthetic ligand 2G0

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fucose-binding lectin PA-IIL

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dcq__assembly_1__model_1

3dcq__assembly_1__model_1 | I(q)

3dcq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)