SAXSdb — 3dl8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein translocase subunit secA

Bacillus subtilis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Preprotein translocase subunit secY × 1 （O66491） SecE × 1 Protein-export membrane protein secG × 1 （O66505）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Preprotein translocase subunit secY × 1 （O66491） SecE × 1 Protein-export membrane protein secG × 1 （O66505）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SECA_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–779； UniProt 1–779 Author chain B； PDBConstruct 1–779； UniProt 1–779

Preprotein translocase subunit secY

Aquifex aeolicus

UniProt O66491

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein translocase subunit secA × 1 （P28366） SecE × 1 Protein-export membrane protein secG × 1 （O66505）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Protein translocase subunit secA × 1 （P28366） SecE × 1 Protein-export membrane protein secG × 1 （O66505）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SECY_AQUAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–429； UniProt 1–429 Author chain H； PDBConstruct 1–429； UniProt 1–429

Protein-export membrane protein secG

Aquifex aeolicus

UniProt O66505

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein translocase subunit secA × 1 （P28366） Preprotein translocase subunit secY × 1 （O66491） SecE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Protein translocase subunit secA × 1 （P28366） Preprotein translocase subunit secY × 1 （O66491） SecE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SECG_AQUAE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–100； UniProt 1–100 Author chain F； PDBConstruct 1–100； UniProt 1–100

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3dl8
Deposition date deposition_date	2008-06-26
Structure title title	Structure of the complex of aquifex aeolicus SecYEG and bacillus subtilis SecA
Keywords keywords	;RecA-type ATPase membrane protein translocation Protein-protein complex, ATP-binding, Cell membrane, Membrane, Metal-binding, Nucleotide-binding, Protein transport, Translocation, Transport, Transmembrane ;; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3dl8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3dl8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3dl8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	35.86 Å
Rg (electron density)	35.42 Å
Total Rg	35.73 Å
Atom count	5116
Residues	1279
Excluded volume	70650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3dl8__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3dl8__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Protein translocase subunit secA
Molecular weight formula_weight	88803.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	10232

MLGILNKMFDPTKRTLNRYEKIANDIDAIRGDYENLSDDALKHKTIEFKERLEKGATTDDLLVEAFAVVREASRRVTGMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNALTGKGVHVVTVNEYLASRDAEQMGKIFEFLGLTVGLNLNSMSKDEKREAYAADITYSTNNELGFDYLRDNMVLYKEQMVQRPLHFAVIDEVDSILIDEARTPLIISGQAAKSTKLYVQANAFVRTLKAEKDYTYDIKTKAVQLTEEGMTKAEKAFGIDNLFDVKHVALNHHINQALKAHVAMQKDVDYVVEDGQVVIVDSFTGRLMKGRRYSEGLHQAIEAKEGLEIQNESMTLATITFQNYFRMYEKLAGMTGTAKTEEEEFRNIYNMQVVTIPTNRPVVRDDRPDLIYRTMEGKFKAVAEDVAQRYMTGQPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQIIEEAGQKGAVTIATNMAGRGTDIKLGEGVKELGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQFYLSMEDELMRRFGAERTMAMLDRFGMDDSTPIQSKMVSRAVESSQKRVEGNNFDSRKQLLQYDDVLRQQREVIYKQRFEVIDSENLREIVENMIKSSLERAIAAYTPREELPEEWKLDGLVDLINTTYLDEGALEKSDIFGKEPDEMLELIMDRIITKYNEKEEQFGKEQMREFEKVIVLRAVDSKWMDHIDAMDQLRQGIHLRAYAQTNPLREYQMEGFAMFEHMIESIEDEVAKFVMKAE

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Preprotein translocase subunit secY
Molecular weight formula_weight	48140.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

MSEYLKALFELKELRQKFIFTLLMFVIYRLGSHIPIPGINPEALRDFLKAFEGSVFALYDIFSGGNLGRLTVFALGVMPYISASIMMQLLTVAIPSLQRLAKEEGDYGRYKINEYTKYLTLFVATVQSLGIAFWIRGQVSPKGIPVVENPGISFILITVLTLVAGTMFLVWIADRITEKGIGNGASLIIFAGIVANFPNAVIQFYEKVKTGDIGPLTLLLIIALIIAIIVGIVYVQEAERRIPIQYPGRQVGRQLYAGRKTYLPIKINPAGVIPIIFAQALLLIPSTLLNFVQNPFIKVIADMFQPGAIFYNFLYVTFIVFFTYFYTAVLINPVELAENLHKAGAFIPGVRPGQDTVKYLERIINRLIFFGALFLSVIALIPILISVWFNIPFYFGGTTALIVVGVALDTFRQIETYLIQKKYKSYVRR

Source Source

Source organism organism	Aquifex aeolicus
NCBI taxonomy ID ncbi_taxonomy_id	63363
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	SecE
Molecular weight formula_weight	7504.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MEKLKEFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKIISFILSLRGSL

Source Source

Source organism organism	Aquifex Aeolicus
NCBI taxonomy ID ncbi_taxonomy_id	63363
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Protein-export membrane protein secG
Molecular weight formula_weight	11358.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MYYALLTLFVIIAVVLIISTLLQKGRGDVGAAFGGGMGQSIFGVGGVETILTKATYWLGALFLVLALLLSVIPKEKGSVVEKSVQTEQSEGKGTTQESGKGHHHHHH

Source Source

Source organism organism	Aquifex aeolicus
NCBI taxonomy ID ncbi_taxonomy_id	63363
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	146.359 Å
Unit-cell length b length_b	167.974 Å
Unit-cell length c length_c	187.722 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	7.500 Å
Low-resolution limit resolution_low	14.990 Å
R factor r_factor	0.3670
R_work r_work	0.3650
R_free r_free	0.3900

Structure of the complex of aquifex aeolicus SecYEG and bacillus subtilis SecA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein translocase subunit secA

State in the Current Structure

Other States of the Same Protein in the Database

Preprotein translocase subunit secY

State in the Current Structure

Other States of the Same Protein in the Database

Protein-export membrane protein secG

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dl8__assembly_1__model_1

3dl8__assembly_1__model_1 | I(q)

3dl8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of the complex of aquifex aeolicus SecYEG and bacillus subtilis SecA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein translocase subunit secA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Preprotein translocase subunit secY

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein-export membrane protein secG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3dl8__assembly_1__model_1

3dl8__assembly_1__model_1 | I(q)

3dl8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)