SAXSdb — 3g8t

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U1 small nuclear ribonucleoprotein A

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Monomer	Protein 1 RNA 2	;RNA (5'-R(AP(A2M)PGPCPGPCPCPAPGPAPAPCP*U)-3') ; × 1 glmS glucosamine-6-phosphate activated ribozyme × 1 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose × 1 MAGNESIUM ION × 2 water × 3	Consistent with all polymers
2	Protein–RNA	Monomer	Protein 1 RNA 2	;RNA (5'-R(AP(A2M)PGPCPGPCPCPAPGPAPAPCP*U)-3') ; × 1 glmS glucosamine-6-phosphate activated ribozyme × 1 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose × 1 MAGNESIUM ION × 5 water × 3	Consistent with all polymers
3	Protein–RNA	Monomer	Protein 1 RNA 2	;RNA (5'-R(AP(A2M)PGPCPGPCPCPAPGPAPAPCP*U)-3') ; × 1 glmS glucosamine-6-phosphate activated ribozyme × 1 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose × 1 MAGNESIUM ION × 3 water × 3	Consistent with all polymers
4	Protein–RNA	Monomer	Protein 1 RNA 2	;RNA (5'-R(AP(A2M)PGPCPGPCPCPAPGPAPAPCP*U)-3') ; × 1 glmS glucosamine-6-phosphate activated ribozyme × 1 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose × 1 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNRPA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–98； UniProt 1–98 Author chain B； PDBConstruct 1–98； UniProt 1–98 Author chain C； PDBConstruct 1–98； UniProt 1–98 Author chain D； PDBConstruct 1–98； UniProt 1–98

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3g8t
Deposition date deposition_date	2009-02-12
Structure title title	Crystal structure of the G33A mutant Bacillus anthracis glmS ribozyme bound to GlcN6P
Keywords keywords	;catalytic RNA, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA binding protein-RNA COMPLEX ;; RNA binding protein/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3g8t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3g8t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3g8t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.04 Å
Rg (electron density)	36.22 Å
Total Rg	36.11 Å
Atom count	4021
Residues	242
Excluded volume	59634 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3g8t__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3g8t__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3g8t__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3g8t__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	U1 small nuclear ribonucleoprotein A
Molecular weight formula_weight	11340.3 kDa
Mutation mutation	Y31H,Q36R
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	16182

MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;RNA (5'-R(AP(A2M)PGPCPGPCPCPAPGPAPAPCP*U)-3') ;
Molecular weight formula_weight	4177.6 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E,F,G,H

AAGCGCCAGAACU

Entity 3 Entity 3 polymer

Description description	glmS glucosamine-6-phosphate activated ribozyme
Molecular weight formula_weight	45608.9 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P,Q,R,S

GGCACCAUUGCACUCCGGUGCCAGUUGACGAGAUGGGGUUUAUCGAGAUUUCGGCGGAUGACUCCCGGUUGUUCAUCACAACCGCAAGCUUUUACUUAAAUCAUUAAGGUGACUUAGUGGACAAAGGUGAAAGUGUGAUGA

Entity 4 Entity 4 non-polymer

Description description	2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose
Molecular weight formula_weight	259.2 kDa
Source method src_method	man
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	82

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3g8tA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	3g8tB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	3g8tC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	3g8tD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

▶

Unit-cell length a length_a	48.389 Å
Unit-cell length b length_b	232.671 Å
Unit-cell length c length_c	106.576 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.21 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	28.230 Å
R factor r_factor	0.2530
R_work r_work	0.2500
R_free r_free	0.3180

Crystal structure of the G33A mutant Bacillus anthracis glmS ribozyme bound to GlcN6P

1. Protein Identity and Related Structures Protein Identity & Related Structures

U1 small nuclear ribonucleoprotein A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3g8t__assembly_1__model_1

3g8t__assembly_1__model_1 | I(q)

3g8t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of the G33A mutant Bacillus anthracis glmS ribozyme bound to GlcN6P

1. Protein Identity and Related Structures Protein Identity & Related Structures

U1 small nuclear ribonucleoprotein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3g8t__assembly_1__model_1

3g8t__assembly_1__model_1 | I(q)

3g8t__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)