7b0y

Structure of a transcribing RNA polymerase II-U1 snRNP complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_CRIGR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1970； UniProt 1–1970

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt A0A0B8RVL1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0B8RVL1_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1174； UniProt 1–1174

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt I3LCH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCH3_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit D

OrganismNot specified

UniProt A0A287ADR4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ADR4_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 43–184

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt I3LSI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LSI7_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit F

OrganismNot specified

UniProt F1SKN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SKN8_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt I3LJZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LJZ9_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt I3LCB2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCB2_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt A0A4X1VYD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VYD0_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–67； UniProt 1–67

DNA-directed RNA polymerase II subunit RPB11-a

OrganismNot specified

UniProt F1RKE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RKE4_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 1–117

RPB12

OrganismNot specified

UniProt I3LN51

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LN51_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–58； UniProt 1–58

U1 small nuclear ribonucleoprotein 70 kDa

OrganismNot specified

UniProt P08621

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU17_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain b； PDBConstruct 1–437； UniProt 1–437

U1 small nuclear ribonucleoprotein A

OrganismNot specified

UniProt P09012

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNRPA_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain c； PDBConstruct 1–282； UniProt 1–282

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain e； PDBConstruct 1–118； UniProt 1–118

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain f； PDBConstruct 1–86； UniProt 1–86

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain g； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain h； PDBConstruct 1–76； UniProt 1–76

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain i； PDBConstruct 1–126； UniProt 1–126

Small nuclear ribonucleoprotein-associated protein

OrganismNot specified

UniProt Q66K91

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein Sm D1 × 1 （P62314） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q66K91_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain j； PDBConstruct 1–231； UniProt 1–231

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 21 DNA 2 RNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit D × 1 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 1 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （I3LN51） Non-template DNA × 1 145-nt RNA × 1 Template DNA × 1 U1 snRNA × 1 U1 small nuclear ribonucleoprotein 70 kDa × 1 （P08621） U1 small nuclear ribonucleoprotein A × 1 （P09012） Small nuclear ribonucleoprotein Sm D2 × 1 （P62316） Small nuclear ribonucleoprotein F × 1 （P62306） Small nuclear ribonucleoprotein E × 1 （P62304） Small nuclear ribonucleoprotein G × 1 （P62308） Small nuclear ribonucleoprotein Sm D3 × 1 （P62318） Small nuclear ribonucleoprotein-associated protein × 1 （Q66K91） ZINC ION × 8 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain k； PDBConstruct 1–119； UniProt 1–119

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7b0y
Deposition date deposition_date	2020-11-23
Structure title title	Structure of a transcribing RNA polymerase II-U1 snRNP complex
Keywords keywords	Transcription, Splicing, co-transcriptional spliceosome assembly; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7b0y__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7b0y__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7b0y__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.95 Å
Rg (electron density)	68.50 Å
Total Rg	68.61 Å
Atom count	43792
Residues	5019
Excluded volume	760780 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7b0y__assembly_1__model_1`	25-meric （25）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (27)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	217450.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	43792

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit D
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase II subunit F
Molecular weight formula_weight	14477.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11-a
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 12 Entity 12 polymer

Description description	RPB12
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 13 Entity 13 polymer

Description description	Non-template DNA
Molecular weight formula_weight	14932.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

CCATTGAGAGCGGCCCTTGTGTTCAGGAGCCAGCAGGGAGCTGGGAGC

Entity 14 Entity 14 polymer

Description description	145-nt RNA
Molecular weight formula_weight	46784.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

GGGCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGCUUGGAUCGGAAACCCGUCGGCCUCCGACAGGUAAGUAUUAACCGGAGAGGGAACCCACU

Entity 15 Entity 15 polymer

Description description	Template DNA
Molecular weight formula_weight	14672.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

GCTCCCAGCTCCCTGCTGGCTCCGAGTGGGTTCTGCCGCTCTCAATGG

Entity 16 Entity 16 polymer

Description description	U1 snRNA
Molecular weight formula_weight	52697.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	a

AUACUUACCUGGCAGGGGAGAUACCAUGAUCACGAAGGUGGUUUUCCCAGGGCGAGGCUUAUCCAUUGCACUCCGGAUGUGCUGACCCCUGCGAUUUCCCCAAAUGUGGGAAACUCGACUGCAUAAUUUGUGGUAGUGGGGGACUGCGUUCGCGCUUUCCCCUG

Entity 17 Entity 17 polymer

Description description	U1 small nuclear ribonucleoprotein 70 kDa
Molecular weight formula_weight	51683.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE

Entity 18 Entity 18 polymer

Description description	U1 small nuclear ribonucleoprotein A
Molecular weight formula_weight	31319.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK

Entity 19 Entity 19 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 20 Entity 20 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 21 Entity 21 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 22 Entity 22 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 23 Entity 23 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 24 Entity 24 polymer

Description description	Small nuclear ribonucleoprotein-associated protein
Molecular weight formula_weight	23686.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL

Entity 25 Entity 25 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 26 Entity 26 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 27 Entity 27 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	7b0yA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	7b0yA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	7b0yB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	61596

Structure of a transcribing RNA polymerase II-U1 snRNP complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer