8r09

Cryo-EM structure of the cross-exon pre-B+5'ss+ATPgammaS complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

U6 snRNA-associated Sm-like protein LSm6

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 66； PDBConstruct 1–80； UniProt 1–80

U6 snRNA-associated Sm-like protein LSm7

OrganismNot specified

UniProt Q9UK45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM7_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 67； PDBConstruct 1–103； UniProt 1–103

U6 snRNA-associated Sm-like protein LSm2

OrganismNot specified

UniProt Q9Y333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 62； PDBConstruct 1–95； UniProt 1–95

U6 snRNA-associated Sm-like protein LSm3

OrganismNot specified

UniProt P62310

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 63； PDBConstruct 1–102； UniProt 1–102

U6 snRNA-associated Sm-like protein LSm8

OrganismNot specified

UniProt O95777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM8_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 68； PDBConstruct 1–96； UniProt 1–96

U6 snRNA-associated Sm-like protein LSm4

OrganismNot specified

UniProt Q9Y4Z0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM4_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 64； PDBConstruct 1–139； UniProt 1–139

U6 snRNA-associated Sm-like protein LSm5

OrganismNot specified

UniProt Q9Y4Y9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LSM5_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 65； PDBConstruct 1–91； UniProt 1–91

U5 small nuclear ribonucleoprotein 40 kDa protein

OrganismNot specified

UniProt Q96DI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNR40_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–357； UniProt 1–357

Splicing factor 3B subunit 4

OrganismNot specified

UniProt Q15427

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B4_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B4； PDBConstruct 1–424； UniProt 1–424

Splicing factor 3A subunit 2

OrganismNot specified

UniProt Q15428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A2_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 8； PDBConstruct 1–464； UniProt 1–464

Splicing factor 3A subunit 3

OrganismNot specified

UniProt Q12874

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A3_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 9； PDBConstruct 1–501； UniProt 1–501

Splicing factor 3B subunit 2

OrganismNot specified

UniProt Q13435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B2_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain B2； PDBConstruct 1–895； UniProt 1–895

Splicing factor 3B subunit 5

OrganismNot specified

UniProt Q9BWJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B5_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain B5； PDBConstruct 1–86； UniProt 1–86

Splicing factor 3B subunit 3

OrganismNot specified

UniProt Q15393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B3_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain B3； PDBConstruct 1–1217； UniProt 1–1217

PHD finger-like domain-containing protein 5A

OrganismNot specified

UniProt Q7RTV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHF5A_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain BP； PDBConstruct 1–110； UniProt 1–110

Splicing factor 3B subunit 1

OrganismNot specified

UniProt O75533

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain B1； PDBConstruct 1–1304； UniProt 1–1304

Splicing factor 3B subunit 6

OrganismNot specified

UniProt Q9Y3B4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3B6_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain B6； PDBConstruct 1–125； UniProt 1–125

Small nuclear ribonucleoprotein Sm D2

OrganismNot specified

UniProt P62316

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD2_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 22； PDBConstruct 1–118； UniProt 1–118 Author chain 42； PDBConstruct 1–118； UniProt 1–118 Author chain 52； PDBConstruct 1–118； UniProt 1–118

;U2 small nuclear ribonucleoprotein B'' ;

OrganismNot specified

UniProt P08579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2B_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain 2B； PDBConstruct 1–225； UniProt 1–225

Small nuclear ribonucleoprotein F

OrganismNot specified

UniProt P62306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXF_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain 2f； PDBConstruct 1–86； UniProt 1–86 Author chain 4f； PDBConstruct 1–86； UniProt 1–86 Author chain 5f； PDBConstruct 1–86； UniProt 1–86

;Small nuclear ribonucleoprotein-associated proteins B and B' ;

OrganismNot specified

UniProt P14678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSMB_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 2b； PDBConstruct 1–240； UniProt 1–240 Author chain 4b； PDBConstruct 1–240； UniProt 1–240 Author chain 5b； PDBConstruct 1–240； UniProt 1–240

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt P62318

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD3_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 23； PDBConstruct 1–126； UniProt 1–126 Author chain 43； PDBConstruct 1–126； UniProt 1–126 Author chain 53； PDBConstruct 1–126； UniProt 1–126

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt P62308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXG_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 2g； PDBConstruct 1–76； UniProt 1–76 Author chain 4g； PDBConstruct 1–76； UniProt 1–76 Author chain 5g； PDBConstruct 1–76； UniProt 1–76

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt P62304

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUXE_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 2e； PDBConstruct 1–92； UniProt 1–92 Author chain 4e； PDBConstruct 1–92； UniProt 1–92 Author chain 5e； PDBConstruct 1–92； UniProt 1–92

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt P62314

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMD1_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 21； PDBConstruct 1–119； UniProt 1–119 Author chain 41； PDBConstruct 1–119； UniProt 1–119 Author chain 51； PDBConstruct 1–119； UniProt 1–119

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt P09661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RU2A_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 2A； PDBConstruct 1–255； UniProt 1–255

U5 small nuclear ribonucleoprotein 200 kDa helicase

OrganismNot specified

UniProt O75643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U520_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain B； PDBConstruct 1–2136； UniProt 1–2136

Peptidyl-prolyl cis-trans isomerase H

OrganismNot specified

UniProt O43447

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPIH_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain W； PDBConstruct 1–177； UniProt 1–177

Probable ATP-dependent RNA helicase DDX23

OrganismNot specified

UniProt Q9BUQ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX23_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain G； PDBConstruct 1–820； UniProt 1–820

U4/U6 small nuclear ribonucleoprotein Prp3

OrganismNot specified

UniProt O43395

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRPF3_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain J； PDBConstruct 1–683； UniProt 1–683

U4/U6 small nuclear ribonucleoprotein Prp31

OrganismNot specified

UniProt Q8WWY3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP31_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain L； PDBConstruct 1–499； UniProt 1–499

U4/U6 small nuclear ribonucleoprotein Prp4

OrganismNot specified

UniProt O43172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP4_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain F； PDBConstruct 1–522； UniProt 1–522

Pre-mRNA-processing factor 6

OrganismNot specified

UniProt O94906

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP6_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain N； PDBConstruct 1–941； UniProt 1–941

Pre-mRNA-processing-splicing factor 8

OrganismNot specified

UniProt Q6P2Q9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRP8_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain A； PDBConstruct 1–2335； UniProt 1–2335

Ubiquitin carboxyl-terminal hydrolase 39

OrganismNot specified

UniProt Q53GS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UBP39_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain U； PDBConstruct 1–565； UniProt 1–565

U4/U6.U5 tri-snRNP-associated protein 1

OrganismNot specified

UniProt O43290

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNUT1_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain S； PDBConstruct 1–800； UniProt 1–800

116 kDa U5 small nuclear ribonucleoprotein component

OrganismNot specified

UniProt Q15029

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	U5S1_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain C； PDBConstruct 1–972； UniProt 1–972

NHP2-like protein 1, N-terminally processed

OrganismNot specified

UniProt P55769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NH2L1_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain M； PDBConstruct 1–128； UniProt 1–128

Thioredoxin-like protein 4A

OrganismNot specified

UniProt P83876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） U5 snRNA × 1 ;5'ss oligo ; × 1 Splicing factor 3A subunit 1 × 1 （Q15459） U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TXN4A_HUMAN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 1–142

Splicing factor 3A subunit 1

OrganismNot specified

UniProt Q15459

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 54 RNA 6	U6 snRNA-associated Sm-like protein LSm6 × 1 （P62312） U6 snRNA-associated Sm-like protein LSm7 × 1 （Q9UK45） U6 snRNA-associated Sm-like protein LSm2 × 1 （Q9Y333） U6 snRNA-associated Sm-like protein LSm3 × 1 （P62310） U6 snRNA-associated Sm-like protein LSm8 × 1 （O95777） U6 snRNA-associated Sm-like protein LSm4 × 1 （Q9Y4Z0） U6 snRNA-associated Sm-like protein LSm5 × 1 （Q9Y4Y9） U5 small nuclear ribonucleoprotein 40 kDa protein × 1 （Q96DI7） Splicing factor 3B subunit 4 × 1 （Q15427） pre-mRNA × 1 Splicing factor 3A subunit 2 × 1 （Q15428） Splicing factor 3A subunit 3 × 1 （Q12874） Splicing factor 3B subunit 2 × 1 （Q13435） Splicing factor 3B subunit 5 × 1 （Q9BWJ5） U2 snRNA × 1 Splicing factor 3B subunit 3 × 1 （Q15393） PHD finger-like domain-containing protein 5A × 1 （Q7RTV0） Splicing factor 3B subunit 1 × 1 （O75533） Splicing factor 3B subunit 6 × 1 （Q9Y3B4） Small nuclear ribonucleoprotein Sm D2 × 3 （P62316） ;U2 small nuclear ribonucleoprotein B'' ; × 1 （P08579） Small nuclear ribonucleoprotein F × 3 （P62306） ;Small nuclear ribonucleoprotein-associated proteins B and B' ; × 3 （P14678） Small nuclear ribonucleoprotein Sm D3 × 3 （P62318） Small nuclear ribonucleoprotein G × 3 （P62308） Small nuclear ribonucleoprotein E × 3 （P62304） Small nuclear ribonucleoprotein Sm D1 × 3 （P62314） ;U2 small nuclear ribonucleoprotein A' ; × 1 （P09661） U5 small nuclear ribonucleoprotein 200 kDa helicase × 1 （O75643） Peptidyl-prolyl cis-trans isomerase H × 1 （O43447） Probable ATP-dependent RNA helicase DDX23 × 1 （Q9BUQ8） U4/U6 small nuclear ribonucleoprotein Prp3 × 1 （O43395） U4/U6 small nuclear ribonucleoprotein Prp31 × 1 （Q8WWY3） U4/U6 small nuclear ribonucleoprotein Prp4 × 1 （O43172） Pre-mRNA-processing factor 6 × 1 （O94906） Pre-mRNA-processing-splicing factor 8 × 1 （Q6P2Q9） Ubiquitin carboxyl-terminal hydrolase 39 × 1 （Q53GS9） U4/U6.U5 tri-snRNP-associated protein 1 × 1 （O43290） 116 kDa U5 small nuclear ribonucleoprotein component × 1 （Q15029） NHP2-like protein 1, N-terminally processed × 1 （P55769） Thioredoxin-like protein 4A × 1 （P83876） U5 snRNA × 1 ;5'ss oligo ; × 1 U4 snRNA × 1 U6 snRNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SF3A1_HUMAN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain 7； PDBConstruct 1–793； UniProt 1–793

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8r09
Deposition date deposition_date	2023-10-31
Structure title title	Cryo-EM structure of the cross-exon pre-B+5'ss+ATPgammaS complex
Keywords keywords	spliceosome, SPLICING; SPLICING
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8r09__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8r09__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8r09__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	121.60 Å
Total Rg	121.90 Å
Atom count	82064
Residues	14638
Excluded volume	1322600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8r09__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (46)

Entity 1 Entity 1 polymer

Description description	U6 snRNA-associated Sm-like protein LSm6
Molecular weight formula_weight	9139.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	66
Atom count atom_count	82094

MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

Entity 2 Entity 2 polymer

Description description	U6 snRNA-associated Sm-like protein LSm7
Molecular weight formula_weight	11617.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	67

MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA

Entity 3 Entity 3 polymer

Description description	U6 snRNA-associated Sm-like protein LSm2
Molecular weight formula_weight	10847.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	62

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Entity 4 Entity 4 polymer

Description description	U6 snRNA-associated Sm-like protein LSm3
Molecular weight formula_weight	11859.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	63

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Entity 5 Entity 5 polymer

Description description	U6 snRNA-associated Sm-like protein LSm8
Molecular weight formula_weight	10410.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	68

MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

Entity 6 Entity 6 polymer

Description description	U6 snRNA-associated Sm-like protein LSm4
Molecular weight formula_weight	15375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	64

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Entity 7 Entity 7 polymer

Description description	U6 snRNA-associated Sm-like protein LSm5
Molecular weight formula_weight	9945.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	65

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Entity 8 Entity 8 polymer

Description description	U5 small nuclear ribonucleoprotein 40 kDa protein
Molecular weight formula_weight	39359.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ

Entity 9 Entity 9 polymer

Description description	Splicing factor 3B subunit 4
Molecular weight formula_weight	44436.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ

Entity 10 Entity 10 polymer

Description description	pre-mRNA
Molecular weight formula_weight	111300.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

GGUACCUAAUACGACUCACUAUAGGGAGACGGAAUUCGAGCUCGCCCACUCUUGGAUCGGAAACCCGUCGGCCUCCGAACGGUAAGAGCCUAGCAUGUAGAACUGGUUACCUGCAGCCCAAGCUUGCUGCACGUCUAGGGCGCAGUAGUCCAGGGUUUCCUUGAUGAUGUCAUACUUAUCCUGUCCCUUUUUUUUCCACAGCUCGCGGUUGAGGACAAACUCUUCGCGGUCUUUCCAGUGGGGAUCCAAUAUCCGUACACCAUCAGGGUACGAGCUAGCCCAUGGCGUACACCAUCAGGGUACGACUAGUAGAUCUCGUACACCAUCAGGGUACGGAAUUCUCUAGA

Entity 11 Entity 11 polymer

Description description	Splicing factor 3A subunit 2
Molecular weight formula_weight	49327.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKPPAPPSLPAGPPGVKRPPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAPVVHPPASGVHPPAPGVHPPAPGVHPPAPGVHPPTSGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPAPGVHPPPSAGVHPQAPGVHPAAPAVHPQAPGVHPPAPGMHPQAPGVHPQPPGVHPSAPGVHPQPPGVHPSNPGVHPPTPMPPMLRPPLPSEGPGNIPPPPPTN

Entity 12 Entity 12 polymer

Description description	Splicing factor 3A subunit 3
Molecular weight formula_weight	58934.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

METILEQQRRYHEEKERLMDVMAKEMLTKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFEELLKARENPSEEAQNLVEFTDEEGYGRYLDLHDCYLKYINLKASEKLDYITYLSIFDQLFDIPKERKNAEYKRYLEMLLEYLQDYTDRVKPLQDQNELFGKIQAEFEKKWENGTFPGWPKETSSALTHAGAHLDLSAFSSWEELASLGLDRLKSALLALGLKCGGTLEERAQRLFSTKGKSLESLDTSLFAKNPKSKGTKRDTERNKDIAFLEAQIYEYVEILGEQRHLTHENVQRKQARTGEEREEEEEEQISESESEDEENEIIYNPKNLPLGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKTYEDLKRQGLL

Entity 13 Entity 13 polymer

Description description	Splicing factor 3B subunit 2
Molecular weight formula_weight	100377.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2

MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Entity 14 Entity 14 polymer

Description description	Splicing factor 3B subunit 5
Molecular weight formula_weight	10149.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Entity 15 Entity 15 polymer

Description description	U2 snRNA
Molecular weight formula_weight	60186.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

AUCGCUUCUCGGCCUUUUGGCUAAGAUCAAGUGUAGUAUCUGUUCUUAUCAGUUUAAUAUCUGAUACGUCCUCUAUCCGAGGACAAUAUAUUAAAUGGAUUUUUGGAGCAGGGAGAUGGAAUAGGAGCUUGCUCCGUCCACUCCACGCAUCGACCUGGUAUUGCAGUACCUCCAGGAACGGUGCACCC

Entity 16 Entity 16 polymer

Description description	Splicing factor 3B subunit 3
Molecular weight formula_weight	135718.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3

MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFGVIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQFLAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENPMFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPGGSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFFFLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQIAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVNATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPGKKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQRSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSIGFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSWLSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFPLQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Entity 17 Entity 17 polymer

Description description	PHD finger-like domain-containing protein 5A
Molecular weight formula_weight	12427.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Entity 18 Entity 18 polymer

Description description	Splicing factor 3B subunit 1
Molecular weight formula_weight	146024.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL

Entity 19 Entity 19 polymer

Description description	Splicing factor 3B subunit 6
Molecular weight formula_weight	14606.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B6

MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Entity 20 Entity 20 polymer

Description description	Small nuclear ribonucleoprotein Sm D2
Molecular weight formula_weight	13551.9 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	22,42,52

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Entity 21 Entity 21 polymer

Description description	;U2 small nuclear ribonucleoprotein B'' ;
Molecular weight formula_weight	25524.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2B

MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK

Entity 22 Entity 22 polymer

Description description	Small nuclear ribonucleoprotein F
Molecular weight formula_weight	9734.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2f,4f,5f

MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

Entity 23 Entity 23 polymer

Description description	;Small nuclear ribonucleoprotein-associated proteins B and B' ;
Molecular weight formula_weight	24642.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2b,4b,5b

MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

Entity 24 Entity 24 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	13940.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	23,43,53

MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR

Entity 25 Entity 25 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	8508.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2g,4g,5g

MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV

Entity 26 Entity 26 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10817.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2e,4e,5e

MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN

Entity 27 Entity 27 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13310.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	21,41,51

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Entity 28 Entity 28 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	28456.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2A

MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Entity 29 Entity 29 polymer

Description description	U5 small nuclear ribonucleoprotein 200 kDa helicase
Molecular weight formula_weight	244823.4 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD

Entity 30 Entity 30 polymer

Description description	Peptidyl-prolyl cis-trans isomerase H
Molecular weight formula_weight	19230.1 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Entity 31 Entity 31 polymer

Description description	Probable ATP-dependent RNA helicase DDX23
Molecular weight formula_weight	95785.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Entity 32 Entity 32 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp3
Molecular weight formula_weight	77669.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

Entity 33 Entity 33 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp31
Molecular weight formula_weight	55529.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST

Entity 34 Entity 34 polymer

Description description	U4/U6 small nuclear ribonucleoprotein Prp4
Molecular weight formula_weight	58536.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

Entity 35 Entity 35 polymer

Description description	Pre-mRNA-processing factor 6
Molecular weight formula_weight	107092.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDMRKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNTQMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEEQKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF

Entity 36 Entity 36 polymer

Description description	Pre-mRNA-processing-splicing factor 8
Molecular weight formula_weight	273974.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYRLANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATKFFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCWKANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGINNLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKCRTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRTDFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYARAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLPGQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Entity 37 Entity 37 polymer

Description description	Ubiquitin carboxyl-terminal hydrolase 39
Molecular weight formula_weight	65481.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETNQQGA

Entity 38 Entity 38 polymer

Description description	U4/U6.U5 tri-snRNP-associated protein 1
Molecular weight formula_weight	90414.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MGSSKKHRGEKEAAGTTAAAGTGGATEQPPRHREHKKHKHRSGGSGGSGGERRKRSRERGGERGSGRRGAEAEARSSTHGRERSQAEPSERRVKREKRDDGYEAAASSKTSSGDASSLSIEETNKLRAKLGLKPLEVNAIKKEAGTKEEPVTADVINPMALRQREELREKLAAAKEKRLLNQKLGKIKTLGEDDPWLDDTAAWIERSRQLQKEKDLAEKRAKLLEEMDQEFGVSTLVEEEFGQRRQDLYSARDLQGLTVEHAIDSFREGETMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGERPHSFRLEQGGTADGLRERELEEIRAKLRLQAQSLSTVGPRLASEYLTPEEMVTFKKTKRRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKGRRLRQLQQLQQLRDSGEKVVEIVKKLESRQRGWEEDEDPERKGAIVFNATSEFCRTLGEIPTYGLAGNREEQEELMDFERDEERSANGGSESDGEENIGWSTVNLDEEKQQQDFSASSTTILDEEPIVNRGLAAALLLCQNKGLLETTVQKVARVKAPNKSLPSAVYCIEDKMAIDDKYSRREEYRGFTQDFKEKDGYKPDVKIEYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKMSSSDTPLGTVALLQEKQKAQKTPYIVLSGSGKSMNANTITK

Entity 39 Entity 39 polymer

Description description	116 kDa U5 small nuclear ribonucleoprotein component
Molecular weight formula_weight	109560.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTERLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTKMYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQTKYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLELAKQDVVLNYPM

Entity 40 Entity 40 polymer

Description description	NHP2-like protein 1, N-terminally processed
Molecular weight formula_weight	14191.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV

Entity 41 Entity 41 polymer

Description description	Thioredoxin-like protein 4A
Molecular weight formula_weight	16807.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY

Entity 42 Entity 42 polymer

Description description	U5 snRNA
Molecular weight formula_weight	37254.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Entity 43 Entity 43 polymer

Description description	;5'ss oligo ;
Molecular weight formula_weight	3555.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	z

AAGGUAAGUAU

Entity 44 Entity 44 polymer

Description description	Splicing factor 3A subunit 1
Molecular weight formula_weight	88991.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK

Entity 45 Entity 45 polymer

Description description	U4 snRNA
Molecular weight formula_weight	46181.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAUUUUUGACAGUCUCUACGGAGACUG

Entity 46 Entity 46 polymer

Description description	U6 snRNA
Molecular weight formula_weight	34098.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

▶

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	411185

Cryo-EM structure of the cross-exon pre-B+5'ss+ATPgammaS complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

U6 snRNA-associated Sm-like protein LSm6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U6 snRNA-associated Sm-like protein LSm5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

U5 small nuclear ribonucleoprotein 40 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3B subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Splicing factor 3A subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer