8wax

De novo transcribing complex 14 (TC14), the early elongation complex with Pol II positioned 14nt downstream of TSS

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alpha-amanitin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AAMAT_AMAPH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain N； PDBConstruct 1–8； UniProt 1–8

General transcription factor IIF subunit 1

Homo sapiens

UniProt P35269

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain S； PDBConstruct 1–517； UniProt 1–517

General transcription factor IIF subunit 2

Homo sapiens

UniProt P13984

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FB_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain T； PDBConstruct 1–249； UniProt 1–249

DNA-directed RNA polymerase subunit

OrganismNot specified

UniProt A0A8D1DPV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1DPV6_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain o； PDBConstruct 1–1970； UniProt 1–1970

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt A0A4X1TVZ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TVZ5_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain p； PDBConstruct 1–1174； UniProt 78–1251

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt I3LCH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCH3_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain q； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt A0A481BYI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A481BYI6_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain r； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt A0A4X1VTX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VTX4_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain s； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit F

OrganismNot specified

UniProt A0A4X1VEK9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VEK9_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain t； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt A0A4X1VKG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VKG7_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain u； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt I3LCB2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCB2_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain v； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain w； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt A0A493TD97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A493TD97_ANAPP
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain x； PDBConstruct 1–67； UniProt 1–67

DNA-directed RNA polymerase II subunit RPB11-a

OrganismNot specified

UniProt F1RKE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RKE4_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain y； PDBConstruct 1–117； UniProt 1–117

RPB12

OrganismNot specified

UniProt A0A4X1TRS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	Alpha-amanitin × 1 （P85421） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） non-template DNA × 1 template DNA × 1 RNA × 1 DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） ZINC ION × 8 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TRS6_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain z； PDBConstruct 1–58； UniProt 1–58

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wax
Deposition date deposition_date	2023-09-08
Structure title title	De novo transcribing complex 14 (TC14), the early elongation complex with Pol II positioned 14nt downstream of TSS
Keywords keywords	transcribing complex, de novo transcription initiation, early elongation complex (EEC), TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wax__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wax__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wax__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.42 Å
Rg (electron density)	52.75 Å
Total Rg	52.90 Å
Atom count	35758
Residues	4287
Excluded volume	629000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wax__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Alpha-amanitin
Molecular weight formula_weight	939.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N
Atom count atom_count	35758

IWGIGCNP

Entity 2 Entity 2 polymer

Description description	General transcription factor IIF subunit 1
Molecular weight formula_weight	58343.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	General transcription factor IIF subunit 2
Molecular weight formula_weight	28427.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	non-template DNA
Molecular weight formula_weight	30617.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

AAGGGCGCCTATAAAAGGGGGTGGTTGTGAGTTCTTCTTCATCAACTTCATCTGGTTCGAGCCGAGCAGACGTGCCTACGGACCATGTCCGAAACTGAC

Entity 5 Entity 5 polymer

Description description	template DNA
Molecular weight formula_weight	30466.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

GTCAGTTTCGGACATGGTCCGTAGGCACGTCTGCTCGGCTCGAACCAGATGAAGTTGATGAAGAAGAACTCACAACCACCCCCTTTTATAGGCGCCCTT

Entity 6 Entity 6 polymer

Description description	RNA
Molecular weight formula_weight	4096.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

UCAACCUCAUCUG

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	217450.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerase II subunit F
Molecular weight formula_weight	14477.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Entity 13 Entity 13 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 14 Entity 14 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 15 Entity 15 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 16 Entity 16 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 17 Entity 17 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11-a
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 18 Entity 18 polymer

Description description	RPB12
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 19 Entity 19 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 20 Entity 20 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ;
Molecular weight formula_weight	537.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	2.75 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	261023

De novo transcribing complex 14 (TC14), the early elongation complex with Pol II positioned 14nt downstream of TSS

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alpha-amanitin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIF subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIF subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer