7eg8

TFIID-based core PIC on PUMA promoter

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1872； UniProt 1–1872

Transcription initiation factor TFIID subunit 2

Homo sapiens

UniProt Q6P1X5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1199； UniProt 1–1199

Transcription initiation factor TFIID subunit 4

Homo sapiens

UniProt O00268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF4_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–1085； UniProt 1–1085 Author chain d； PDBConstruct 1–1085； UniProt 1–1085

Transcription initiation factor TFIID subunit 5

Homo sapiens

UniProt Q15542

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–800； UniProt 1–800 Author chain e； PDBConstruct 1–800； UniProt 1–800

Transcription initiation factor TFIID subunit 6

Homo sapiens

UniProt P49848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–677； UniProt 1–677 Author chain f； PDBConstruct 1–677； UniProt 1–677

Transcription initiation factor TFIID subunit 7

Homo sapiens

UniProt Q15545

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF7_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–349； UniProt 1–349

Transcription initiation factor TFIID subunit 8

Homo sapiens

UniProt Q7Z7C8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF8_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–310； UniProt 1–310

Transcription initiation factor TFIID subunit 9

Homo sapiens

UniProt Q16594

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–264； UniProt 1–264 Author chain i； PDBConstruct 1–264； UniProt 1–264

Transcription initiation factor TFIID subunit 10

Homo sapiens

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–218； UniProt 1–218 Author chain j； PDBConstruct 1–218； UniProt 1–218

Transcription initiation factor TFIID subunit 12

Homo sapiens

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–161； UniProt 1–161 Author chain l； PDBConstruct 1–161； UniProt 1–161

Transcription initiation factor IIA subunit 2

Homo sapiens

UniProt P52657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2AG_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–109； UniProt 1–109

TATA-box-binding protein

Homo sapiens

UniProt P20226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–339； UniProt 1–339

Transcription initiation factor IIA subunit 1

Homo sapiens

UniProt P52655

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2AA_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–376； UniProt 1–376

Transcription initiation factor IIB

Homo sapiens

UniProt Q00403

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2B_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–316； UniProt 1–316

General transcription factor IIF subunit 1

Homo sapiens

UniProt P35269

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain S； PDBConstruct 1–517； UniProt 1–517

General transcription factor IIF subunit 2

Homo sapiens

UniProt P13984

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FB_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain T； PDBConstruct 1–249； UniProt 1–249

Transcription initiation factor TFIID subunit 3

Homo sapiens

UniProt Q5VWG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF3_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain c； PDBConstruct 1–929； UniProt 1–929

Transcription initiation factor TFIID subunit 11

Homo sapiens

UniProt Q15544

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF11_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain k； PDBConstruct 1–211； UniProt 1–211

Transcription initiation factor TFIID subunit 13

Homo sapiens

UniProt Q15543

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF13_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain m； PDBConstruct 1–124； UniProt 1–124

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt A0A4X1TVZ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TVZ5_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain p； PDBConstruct 1–1174； UniProt 78–1251

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt I3LCH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCH3_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain q； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt A0A481BYI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A481BYI6_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain r； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt I3LSI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LSI7_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain s； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit F

OrganismNot specified

UniProt A0A4X1VEK9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VEK9_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain t； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt A0A4X1VKG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VKG7_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain u； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt A0A4X1ULF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1ULF2_PIG
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain v； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain w； PDBConstruct 1–125； UniProt 1–125

RNA_pol_L_2 domain-containing protein

OrganismNot specified

UniProt A0A4X1UK25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RPB12 × 1 （A0A4X1TRS6） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1UK25_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain y； PDBConstruct 1–117； UniProt 1–117

RPB12

OrganismNot specified

UniProt A0A4X1TRS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 37 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） DNA (85-MER) × 1 DNA (85-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） ZINC ION × 9 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TRS6_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain z； PDBConstruct 1–58； UniProt 1–58

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7eg8
Deposition date deposition_date	2021-03-24
Structure title title	TFIID-based core PIC on PUMA promoter
Keywords keywords	TFIID, preinitiation complex, core promoter, transcription initiation, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7eg8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7eg8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7eg8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	93.97 Å
Rg (electron density)	93.89 Å
Total Rg	93.73 Å
Atom count	82798
Residues	10092
Excluded volume	1465300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7eg8__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor TFIID subunit 1
Molecular weight formula_weight	212956.2 kDa
EC 编号 ec_number	2.3.1.48,2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	82798

MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Transcription initiation factor TFIID subunit 2
Molecular weight formula_weight	137160.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSGTSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Transcription initiation factor TFIID subunit 4
Molecular weight formula_weight	110221.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Transcription initiation factor TFIID subunit 5
Molecular weight formula_weight	86932.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	72749.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Transcription initiation factor TFIID subunit 7
Molecular weight formula_weight	40325.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 8
Molecular weight formula_weight	34304.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 9
Molecular weight formula_weight	29006.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	12469.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	37729.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	Transcription initiation factor IIA subunit 1
Molecular weight formula_weight	41544.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	Transcription initiation factor IIB
Molecular weight formula_weight	34877.9 kDa
EC 编号 ec_number	2.3.1.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	General transcription factor IIF subunit 1
Molecular weight formula_weight	58343.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 16 Entity 16 polymer

Description description	General transcription factor IIF subunit 2
Molecular weight formula_weight	28427.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 17 Entity 17 polymer

Description description	DNA (85-MER)
Molecular weight formula_weight	26326.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

AGAAGTCTGACATCCTTACTCAGCCAGCCCCACACTAGGCACTGGAAGGTGAGTCACTCTGGTGAGGCGATTGCGATTGGGTGAG

Entity 18 Entity 18 polymer

Description description	DNA (85-MER)
Molecular weight formula_weight	26108.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

CTCACCCAATCGCAATCGCCTCACCAGAGTGACTCACCTTCCAGTGCCTAGTGTGGGGCTGGCTGAGTAAGGATGTCAGACTTCT

Entity 19 Entity 19 polymer

Description description	Transcription initiation factor TFIID subunit 3
Molecular weight formula_weight	103769.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLAPPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 20 Entity 20 polymer

Description description	Transcription initiation factor TFIID subunit 11
Molecular weight formula_weight	23340.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 21 Entity 21 polymer

Description description	Transcription initiation factor TFIID subunit 13
Molecular weight formula_weight	14307.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 22 Entity 22 polymer

Description description	RPB1
Molecular weight formula_weight	217420.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 23 Entity 23 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 24 Entity 24 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 25 Entity 25 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 26 Entity 26 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 27 Entity 27 polymer

Description description	DNA-directed RNA polymerase II subunit F
Molecular weight formula_weight	14477.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Entity 28 Entity 28 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 29 Entity 29 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 30 Entity 30 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 31 Entity 31 polymer

Description description	RPB10
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 32 Entity 32 polymer

Description description	RNA_pol_L_2 domain-containing protein
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 33 Entity 33 polymer

Description description	RPB12
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 34 Entity 34 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 35 Entity 35 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	7186

TFIID-based core PIC on PUMA promoter

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer