7egd

SCP promoter-bound TFIID-TFIIA in initial TBP-loading state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1872； UniProt 1–1872

Transcription initiation factor TFIID subunit 2

Homo sapiens

UniProt Q6P1X5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1199； UniProt 1–1199

Transcription initiation factor TFIID subunit 4

Homo sapiens

UniProt O00268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF4_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–1085； UniProt 1–1085 Author chain d； PDBConstruct 1–1085； UniProt 1–1085

Transcription initiation factor TFIID subunit 5

Homo sapiens

UniProt Q15542

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–800； UniProt 1–800 Author chain e； PDBConstruct 1–800； UniProt 1–800

Transcription initiation factor TFIID subunit 6

Homo sapiens

UniProt P49848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–677； UniProt 1–677 Author chain f； PDBConstruct 1–677； UniProt 1–677

Transcription initiation factor TFIID subunit 7

Homo sapiens

UniProt Q15545

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF7_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–349； UniProt 1–349

Transcription initiation factor TFIID subunit 8

Homo sapiens

UniProt Q7Z7C8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF8_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–310； UniProt 1–310

Transcription initiation factor TFIID subunit 9

Homo sapiens

UniProt Q16594

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–264； UniProt 1–264 Author chain i； PDBConstruct 1–264； UniProt 1–264

Transcription initiation factor TFIID subunit 10

Homo sapiens

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–218； UniProt 1–218 Author chain j； PDBConstruct 1–218； UniProt 1–218

Transcription initiation factor TFIID subunit 12

Homo sapiens

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–161； UniProt 1–161 Author chain l； PDBConstruct 1–161； UniProt 1–161

Transcription initiation factor IIA subunit 2

Homo sapiens

UniProt P52657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2AG_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–109； UniProt 1–109

TATA-box-binding protein

Homo sapiens

UniProt P20226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–339； UniProt 1–339

Transcription initiation factor IIA subunit 1

Homo sapiens

UniProt P52655

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2AA_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–376； UniProt 1–376

Transcription initiation factor TFIID subunit 3

Homo sapiens

UniProt Q5VWG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF3_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain c； PDBConstruct 1–929； UniProt 1–929

Transcription initiation factor TFIID subunit 11

Homo sapiens

UniProt Q15544

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 13 × 1 （Q15543）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF11_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain k； PDBConstruct 1–211； UniProt 1–211

Transcription initiation factor TFIID subunit 13

Homo sapiens

UniProt Q15543

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 22 DNA 2	Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA subunit 1 × 1 （P52655） DNA (72-MER) × 1 DNA (72-MER) × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF13_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain m； PDBConstruct 1–124； UniProt 1–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7egd
Deposition date deposition_date	2021-03-24
Structure title title	SCP promoter-bound TFIID-TFIIA in initial TBP-loading state
Keywords keywords	TFIID, preinitiation complex, core promoter, transcription initiation, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7egd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7egd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7egd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	79.34 Å
Rg (electron density)	78.55 Å
Total Rg	78.75 Å
Atom count	46820
Residues	5617
Excluded volume	825170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7egd__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor TFIID subunit 1
Molecular weight formula_weight	212956.2 kDa
EC 编号 ec_number	2.3.1.48,2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	46820

MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Transcription initiation factor TFIID subunit 2
Molecular weight formula_weight	137160.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSGTSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Transcription initiation factor TFIID subunit 4
Molecular weight formula_weight	110221.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Transcription initiation factor TFIID subunit 5
Molecular weight formula_weight	86932.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	72749.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Transcription initiation factor TFIID subunit 7
Molecular weight formula_weight	40325.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 8
Molecular weight formula_weight	34304.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 9
Molecular weight formula_weight	29006.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	12469.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	37729.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	Transcription initiation factor IIA subunit 1
Molecular weight formula_weight	41544.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	DNA (72-MER)
Molecular weight formula_weight	22317.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

CTATAAAAGGGGGTGGGGGCGCGTTCGTCCTCAGTCGCGATCGAACACTCGAGCCGAGCAGACGTGCCTACG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	DNA (72-MER)
Molecular weight formula_weight	22090.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

CGTAGGCACGTCTGCTCGGCTCGAGTGTTCGATCGCGACTGAGGACGAACGCGCCCCCACCCCCTTTTATAG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 16 Entity 16 polymer

Description description	Transcription initiation factor TFIID subunit 3
Molecular weight formula_weight	103769.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLAPPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 17 Entity 17 polymer

Description description	Transcription initiation factor TFIID subunit 11
Molecular weight formula_weight	23340.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 18 Entity 18 polymer

Description description	Transcription initiation factor TFIID subunit 13
Molecular weight formula_weight	14307.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	6.75 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	100170

SCP promoter-bound TFIID-TFIIA in initial TBP-loading state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer