5iyc

Human core-PIC in the initial transcribing state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1970； UniProt 1–1970

DNA-directed RNA polymerase II subunit RPB2

OrganismNot specified

UniProt P30876

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1174； UniProt 1–1174

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt P19387

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt O15514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase II subunit RPB5

OrganismNot specified

UniProt P19388

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit RPB6

OrganismNot specified

UniProt P61218

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB2_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt P62487

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerase II subunit RPB8

OrganismNot specified

UniProt P52434

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB3_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P36954

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerase II subunit RPB10

OrganismNot specified

UniProt P62875

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB5_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–67； UniProt 1–67

DNA-directed RNA polymerase II subunit RPB11-a

OrganismNot specified

UniProt P52435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB11_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 1–117

DNA-directed RNA polymerase II subunit RPB12

OrganismNot specified

UniProt P53803

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPAB4_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–58； UniProt 1–58

Transcription initiation factor IIB

Homo sapiens

UniProt Q00403

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2B_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–316； UniProt 1–316

Transcription initiation factor IIA subunit 1

Homo sapiens

UniProt P52655

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2AA_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–376； UniProt 1–376

Transcription initiation factor IIA subunit 2

Homo sapiens

UniProt P52657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2AG_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–109； UniProt 1–109

TATA-box-binding protein

Homo sapiens

UniProt P20226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain P； PDBConstruct 1–339； UniProt 1–339

General transcription factor IIE subunit 1

Homo sapiens

UniProt P29083

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EA_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Q； PDBConstruct 1–439； UniProt 1–439

Transcription initiation factor IIE subunit beta

Homo sapiens

UniProt P29084

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EB_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain R； PDBConstruct 1–291； UniProt 1–291

General transcription factor IIF subunit 1

Homo sapiens

UniProt P35269

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 2 × 1 （P13984） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain S； PDBConstruct 1–517； UniProt 1–517

General transcription factor IIF subunit 2

Homo sapiens

UniProt P13984

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） Transcription elongation factor A protein 1 × 1 （P23193） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FB_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain T； PDBConstruct 1–249； UniProt 1–249

Transcription elongation factor A protein 1

Homo sapiens

UniProt P23193

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 21 DNA 2	DNA-directed RNA polymerase II subunit RPB1 × 1 （P24928） DNA-directed RNA polymerase II subunit RPB2 × 1 （P30876） DNA-directed RNA polymerase II subunit RPB3 × 1 （P19387） DNA-directed RNA polymerase II subunit RPB4 × 1 （O15514） DNA-directed RNA polymerase II subunit RPB5 × 1 （P19388） DNA-directed RNA polymerase II subunit RPB6 × 1 （P61218） DNA-directed RNA polymerase II subunit RPB7 × 1 （P62487） DNA-directed RNA polymerase II subunit RPB8 × 1 （P52434） DNA-directed RNA polymerase II subunit RPB9 × 1 （P36954） DNA-directed RNA polymerase II subunit RPB10 × 1 （P62875） DNA-directed RNA polymerase II subunit RPB11-a × 1 （P52435） DNA-directed RNA polymerase II subunit RPB12 × 1 （P53803） Transcription initiation factor IIB × 1 （Q00403） Transcription initiation factor IIA subunit 1 × 1 （P52655） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） SCP-X × 1 SCP-Y × 1 MAGNESIUM ION × 2 ZINC ION × 11	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCEA1_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain U； PDBConstruct 1–301； UniProt 1–301

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5iyc
Deposition date deposition_date	2016-03-24
Structure title title	Human core-PIC in the initial transcribing state
Keywords keywords	initiation, RNA polymerase II, human, TRANSCRIPTION, TRANSFERASE-DNA complex; TRANSCRIPTION, TRANSFERASE/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5iyc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5iyc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5iyc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.35 Å
Rg (electron density)	59.95 Å
Total Rg	59.98 Å
Atom count	47927
Residues	5737
Excluded volume	843560 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5iyc__assembly_1__model_1`	23-meric （23）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (25)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	217420.0 kDa
EC 编号 ec_number	2.7.7.6,2.7.7.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	47927

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II subunit RPB2
Molecular weight formula_weight	134071.5 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELESTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31478.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II subunit RPB5
Molecular weight formula_weight	24584.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase II subunit RPB6
Molecular weight formula_weight	14491.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase II subunit RPB8
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase II subunit RPB10
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 11 Entity 11 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11-a
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerase II subunit RPB12
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 13 Entity 13 polymer

Description description	Transcription initiation factor IIB
Molecular weight formula_weight	34877.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 14 Entity 14 polymer

Description description	Transcription initiation factor IIA subunit 1
Molecular weight formula_weight	41544.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 15 Entity 15 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	12469.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 16 Entity 16 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	37729.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 17 Entity 17 polymer

Description description	General transcription factor IIE subunit 1
Molecular weight formula_weight	49516.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 18 Entity 18 polymer

Description description	Transcription initiation factor IIE subunit beta
Molecular weight formula_weight	33106.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 19 Entity 19 polymer

Description description	General transcription factor IIF subunit 1
Molecular weight formula_weight	58343.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 20 Entity 20 polymer

Description description	General transcription factor IIF subunit 2
Molecular weight formula_weight	28427.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 21 Entity 21 polymer

Description description	Transcription elongation factor A protein 1
Molecular weight formula_weight	34022.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPSTEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 22 Entity 22 polymer

Description description	SCP-X
Molecular weight formula_weight	24800.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

GAAGGGCGCCTATAAAAGGGGGTGGGGGCGTTTTTTTTTTTTTTTTTTTTCGAACACTCGAGCCGAGCAGACGTGCCTAC

Entity 23 Entity 23 polymer

Description description	SCP-Y
Molecular weight formula_weight	24513.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

GTAGGCACGTCTGCTCGGCTCGAGTGTTCGATCGCGACTGAGGACGAACGCGCCCCCACCCCCTTTTATAGGCGCCCTTC

Entity 24 Entity 24 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	11

▼

6. Fold Classification (SCOP + CATH) 23 domains

CATH v4.4 (23 domains)

Domain ID domain_id	5iycA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	5iycA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	5iycB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	5iycB02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1800 — DCoH-like
Homologous superfamily homologous superfamily	10 — RNA polymerase alpha subunit dimerisation domain

Domain ID domain_id	5iycC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	5iycC02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	5iycD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	40 — RNA Polymerase II, Rpb4 subunit

Domain ID domain_id	5iycE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1340 — Dna-directed Rna Polymerases I, Ii, And Iii 27 Kd Polypeptide; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — RNA polymerase, Rpb5, N-terminal domain

Domain ID domain_id	5iycE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	5iycF00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	5iycG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	5iycG02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	5iycH01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	5iycI02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	5iycJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	5iycK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	5iycL00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

Domain ID domain_id	5iycM01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	472 — Cyclin A; domain 1
Homologous superfamily homologous superfamily	10 — Cyclin-like

Domain ID domain_id	5iycM02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	472 — Cyclin A; domain 1
Homologous superfamily homologous superfamily	10 — Cyclin-like

Domain ID domain_id	5iycO01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	190 — Transcription factor IIA gamma subunit, alpha-helical domain

Domain ID domain_id	5iycO02
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	18 — TATA box binding Protein, subunit D; domain 2
Homologous superfamily homologous superfamily	10 — Transcription factor IIA (TFIIA), beta-barrel domain

Domain ID domain_id	5iycP01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	10 — TATA-Binding Protein

Domain ID domain_id	5iycP02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	10 — TATA-Binding Protein

▶

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	90590

Human core-PIC in the initial transcribing state

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer