6mzm

Human TFIID bound to promoter DNA and TFIIA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 2, TAF2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1199； UniProt 1–1199

Transcription initiation factor TFIID subunit 4, TAF4

OrganismNot specified

UniProt O00268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF4_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–1025； UniProt 61–1085

Transcription initiation factor TFIID subunit 5,TAF5

OrganismNot specified

UniProt Q15542

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–496； UniProt 1–496 Author chain G； PDBConstruct 537–800； UniProt 537–800

Transcription initiation factor TFIID subunit 6

OrganismNot specified

UniProt P49848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6_HUMAN
Isoform	—
PDB entities	5, 6
Chains and sequence ranges	Author chain H； PDBConstruct 1–677； UniProt 1–677 Author chain I； PDBConstruct 1–206； UniProt 38–243 Author chain I； PDBConstruct 217–677； UniProt 207–667

Transcription initiation factor TFIID subunit 7

OrganismNot specified

UniProt Q15545

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–349； UniProt 1–349

Transcription initiation factor TFIID subunit 8, TAF8

OrganismNot specified

UniProt Q7Z7C8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain K； PDBConstruct 1–310； UniProt 1–310

Transcription initiation factor TFIID subunit 9, TAF9

OrganismNot specified

UniProt Q16594

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–264； UniProt 1–264

Transcription initiation factor TFIID subunit 10

OrganismNot specified

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain O； PDBConstruct 1–218； UniProt 1–218

Transcription initiation factor TFIID subunit 12

OrganismNot specified

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain R； PDBConstruct 1–161； UniProt 1–161

TATA-box-binding protein

OrganismNot specified

UniProt P20226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Transcription initiation factor IIA subunit 2 × 1 （P52657） Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain T； PDBConstruct 1–339； UniProt 1–339

Transcription initiation factor IIA subunit 2

Homo sapiens

UniProt P52657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Transcription initiation factor TFIID subunit 1, TAF1 × 1 Transcription initiation factor TFIID subunit 2, TAF2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4, TAF4 × 1 （O00268） Transcription initiation factor TFIID subunit 5,TAF5 × 1 （Q15542） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 6 × 1 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8, TAF8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9, TAF9 × 1 （Q16594） Transcription initiation factor TFIID subunit 10 × 1 （Q12962） Transcription initiation factor TFIID subunit 12 × 1 （Q16514） TATA-box-binding protein × 1 （P20226） SCP DNA (80-MER) × 1 SCP DNA (80-MER) × 1 Transcription initiation factor IIA subunit 1 × 1 Unk × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2AG_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain X； PDBConstruct 1–97； UniProt 3–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6mzm
Deposition date deposition_date	2018-11-05
Structure title title	Human TFIID bound to promoter DNA and TFIIA
Keywords keywords	Transcription, DNA, Nuclear, transcription-dna complex; transcription/dna
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6mzm__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6mzm__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6mzm__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	80.05 Å
Rg (electron density)	79.62 Å
Total Rg	79.89 Å
Atom count	32243
Residues	3960
Excluded volume	561770 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6mzm__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Transcription initiation factor TFIID subunit 1, TAF1
Molecular weight formula_weight	57193.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	32243

IIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVL

Entity 2 Entity 2 polymer

Description description	Transcription initiation factor TFIID subunit 2, TAF2
Molecular weight formula_weight	137160.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSGTSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD

Entity 3 Entity 3 polymer

Description description	Transcription initiation factor TFIID subunit 4, TAF4
Molecular weight formula_weight	104052.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

HVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK

Entity 4 Entity 4 polymer

Description description	Transcription initiation factor TFIID subunit 5,TAF5
Molecular weight formula_weight	85785.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	72749.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP

Entity 6 Entity 6 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	72365.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLXXXXXXXXXXSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 7
Molecular weight formula_weight	40325.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 8, TAF8
Molecular weight formula_weight	32975.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS

Entity 9 Entity 9 polymer

Description description	Transcription initiation factor TFIID subunit 9, TAF9
Molecular weight formula_weight	28830.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPXXXXXXXPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL

Entity 10 Entity 10 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Entity 11 Entity 11 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Entity 12 Entity 12 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	37729.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Entity 13 Entity 13 polymer

Description description	SCP DNA (80-MER)
Molecular weight formula_weight	24498.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	U

CCGTAGGCACGTCTGCTCGGCTCGAGTGTTCGATCGCGACTGAGGACGAACGCGCCCCCACCCCCTTTTATAGGCGCCCT

Entity 14 Entity 14 polymer

Description description	SCP DNA (80-MER)
Molecular weight formula_weight	24854.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	V

AGGGCGCCTATAAAAGGGGGTGGGGGCGCGTTCGTCCTCAGTCGCGATCGAACACTCGAGCCGAGCAGACGTGCCTACGG

Entity 15 Entity 15 polymer

Description description	Transcription initiation factor IIA subunit 1
Molecular weight formula_weight	10675.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 16 Entity 16 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	11275.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

YQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 17 Entity 17 polymer

Description description	Unk
Molecular weight formula_weight	20272.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	25180

Human TFIID bound to promoter DNA and TFIIA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription initiation factor TFIID subunit 2, TAF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 4, TAF4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 5,TAF5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 8, TAF8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 9, TAF9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TATA-box-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer