7f4g

Structure of RPAP2-bound RNA polymerase II

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TVZ5_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1174； UniProt 78–1251

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt I3LCH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCH3_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt A0A4X1VTX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VTX4_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit F

OrganismNot specified

UniProt A0A4X1VEK9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VEK9_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt A0A4X1ULF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1ULF2_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125

RNA_pol_L_2 domain-containing protein

OrganismNot specified

UniProt A0A4X1UK25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1UK25_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 1–117

RPB12

OrganismNot specified

UniProt A0A4X1TRS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TRS6_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–58； UniProt 1–58

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt A0A481BYI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A481BYI6_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt A0A4X1VKG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	RPB1 × 1 DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） RPB10 × 1 RNA_pol_L_2 domain-containing protein × 1 （A0A4X1UK25） RPB12 × 1 （A0A4X1TRS6） RPAP2 × 1 DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VKG7_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain G； PDBConstruct 1–172； UniProt 1–172

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7f4g
Deposition date deposition_date	2021-06-18
Structure title title	Structure of RPAP2-bound RNA polymerase II
Keywords keywords	RPAP2, RNA Polymerase II, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7f4g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7f4g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7f4g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.04 Å
Rg (electron density)	52.42 Å
Total Rg	52.63 Å
Atom count	27957
Residues	3491
Excluded volume	498850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7f4g__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	RPB1
Molecular weight formula_weight	217420.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	27957

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II subunit F
Molecular weight formula_weight	14477.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 8 Entity 8 polymer

Description description	RPB10
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 9 Entity 9 polymer

Description description	RNA_pol_L_2 domain-containing protein
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 10 Entity 10 polymer

Description description	RPB12
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 11 Entity 11 polymer

Description description	RPAP2
Molecular weight formula_weight	69614.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MADFAGPSSAGRKAGAPRCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALHIVEQLLEENITEEFLMECGRFITPAHYSDVVDERSIVKLCGYPLCQKKLGIVPKQKYKISTKTNKVYDITERKSFCSNFCYQASKFFEAQIPKTPVWVREEERHPDFQLLKEEQSGHSGEEVQLCSKAIKTSDIDNPSHFEKQYESSSSSTHSDSSSDNEQDFVSSILPGNRPNSTNIRPQLHQKSIMKKKAGHKANSKHKDKEQTVVDVTEQLGDCKLDSQEKDATCELPLQKVNTQSSSNSTLPERLKASENSESEYSRSEITLVGISKKSAEHFKRKFAKSNQVSRSVSSSVQVCPEVGKRNLLKVLKETLIEWKTEETLRFLYGQNYASVCLKPEASLVKEELDEDDIISDPDSHFPAWRESQNSLDESLPFRGSGTAIKPLPSYENLKKETEKLNLRIREFYRGRYVLGEETTKSQDSEEHDSTFPLIDSSSQNQIRKRIVLEKLSKVLPGLLVPLQITLGDIYTQLKNLVRTFRLTNRNIIHKPAEWTLIAMVLLSLLTPILGIQKHSQEGMVFTRFLDTLLEELHLKNEDLESLTIIFRTSCLPE

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 13 Entity 13 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 14 Entity 14 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	5

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d7f4gd_
Class class	a — All alpha proteins
Fold Fold fold	a.60 — SAM domain-like
Superfamily Superfamily superfamily	a.60.8 — HRDC-like
Family Family family	a.60.8.2 — RNA polymerase II subunit RBP4 (RpoF)

Domain ID domain_id	d7f4gg1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.230 — Dodecin subunit-like
Superfamily Superfamily superfamily	d.230.1 — N-terminal, heterodimerisation domain of RBP7 (RpoE)
Family Family family	d.230.1.1 — N-terminal, heterodimerisation domain of RBP7 (RpoE)

Domain ID domain_id	d7f4gg2
Class class	b — All beta proteins
Fold Fold fold	b.40 — OB-fold
Superfamily Superfamily superfamily	b.40.4 — Nucleic acid-binding proteins
Family Family family	b.40.4.5 — Cold shock DNA-binding domain-like

Domain ID domain_id	d7f4gh_
Class class	b — All beta proteins
Fold Fold fold	b.40 — OB-fold
Superfamily Superfamily superfamily	b.40.4 — Nucleic acid-binding proteins
Family Family family	b.40.4.0 — automated matches

Domain ID domain_id	d7f4gj_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.11 — RNA polymerase subunit RPB10
Family Family family	a.4.11.1 — RNA polymerase subunit RPB10

Domain ID domain_id	d7f4gk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.74 — DCoH-like
Superfamily Superfamily superfamily	d.74.3 — RBP11-like subunits of RNA polymerase
Family Family family	d.74.3.0 — automated matches

Domain ID domain_id	d7f4gl_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.9 — RNA polymerase subunits
Family Family family	g.41.9.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	7f4gB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.78 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	646517

Structure of RPAP2-bound RNA polymerase II

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA_pol_L_2 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RPB12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer