8was

Structure of transcribing complex 9 (TC9), the initially transcribing complex with Pol II positioned 9nt downstream of TSS.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CDK-activating kinase assembly factor MAT1

Homo sapiens

UniProt P51948

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MAT1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–309； UniProt 1–309

General transcription factor IIH subunit 1

Homo sapiens

UniProt P32780

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–548； UniProt 1–548

General transcription factor IIH subunit 2

Homo sapiens

UniProt Q13888

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–395； UniProt 1–395

General transcription factor IIH subunit 3

Homo sapiens

UniProt Q13889

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–308； UniProt 1–308

General transcription factor IIH subunit 4

Homo sapiens

UniProt Q92759

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 1–462； UniProt 1–462

General transcription factor IIH subunit 5

Homo sapiens

UniProt Q6ZYL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2H5_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 5； PDBConstruct 1–71； UniProt 1–71

General transcription and DNA repair factor IIH helicase subunit XPB

Homo sapiens

UniProt P19447

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERCC3_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 1–782； UniProt 1–782

General transcription and DNA repair factor IIH helicase subunit XPD

Homo sapiens

UniProt P18074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERCC2_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–760； UniProt 1–760

Alpha-amanitin

OrganismNot specified

UniProt P85421

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AAMAT_AMAPH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain N； PDBConstruct 1–8； UniProt 1–8

Transcription initiation factor TFIID subunit 1

Homo sapiens

UniProt P21675

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF1_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A； PDBConstruct 1–1872； UniProt 1–1872

Transcription initiation factor TFIID subunit 2

Homo sapiens

UniProt Q6P1X5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF2_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain B； PDBConstruct 1–1199； UniProt 1–1199

Transcription initiation factor TFIID subunit 4

Homo sapiens

UniProt O00268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF4_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain D； PDBConstruct 1–1085； UniProt 1–1085 Author chain d； PDBConstruct 1–1085； UniProt 1–1085

Transcription initiation factor TFIID subunit 5

Homo sapiens

UniProt Q15542

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF5_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain E； PDBConstruct 1–800； UniProt 1–800 Author chain e； PDBConstruct 1–800； UniProt 1–800

Transcription initiation factor TFIID subunit 6

Homo sapiens

UniProt P49848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF6_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain F； PDBConstruct 1–677； UniProt 1–677 Author chain f； PDBConstruct 1–677； UniProt 1–677

Transcription initiation factor TFIID subunit 7

Homo sapiens

UniProt Q15545

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF7_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain G； PDBConstruct 1–349； UniProt 1–349

Transcription initiation factor TFIID subunit 8

Homo sapiens

UniProt Q7Z7C8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF8_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain H； PDBConstruct 1–310； UniProt 1–310

Transcription initiation factor TFIID subunit 9

Homo sapiens

UniProt Q16594

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF9_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain I； PDBConstruct 1–264； UniProt 1–264 Author chain i； PDBConstruct 1–264； UniProt 1–264

Transcription initiation factor TFIID subunit 10

Homo sapiens

UniProt Q12962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF10_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain J； PDBConstruct 1–218； UniProt 1–218 Author chain j； PDBConstruct 1–218； UniProt 1–218

Transcription initiation factor TFIID subunit 12

Homo sapiens

UniProt Q16514

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF12_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain L； PDBConstruct 1–161； UniProt 1–161 Author chain l； PDBConstruct 1–161； UniProt 1–161

Transcription initiation factor IIA subunit 2

Homo sapiens

UniProt P52657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2AG_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain O； PDBConstruct 1–109； UniProt 1–109

TATA-box-binding protein

Homo sapiens

UniProt P20226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain P； PDBConstruct 1–339； UniProt 1–339

Transcription initiation factor IIA beta chain

Homo sapiens

UniProt P52655

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2AA_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Q； PDBConstruct 1–376； UniProt 1–376

Transcription initiation factor IIB

Homo sapiens

UniProt Q00403

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF2B_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain R； PDBConstruct 1–316； UniProt 1–316

General transcription factor IIF subunit 1

Homo sapiens

UniProt P35269

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FA_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain S； PDBConstruct 1–517； UniProt 1–517

General transcription factor IIF subunit 2

Homo sapiens

UniProt P13984

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2FB_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain T； PDBConstruct 1–249； UniProt 1–249

General transcription factor IIE subunit 1

Homo sapiens

UniProt P29083

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EA_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain U； PDBConstruct 1–439； UniProt 1–439

Transcription initiation factor IIE subunit beta

Homo sapiens

UniProt P29084

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T2EB_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain V； PDBConstruct 1–291； UniProt 1–291

Transcription initiation factor TFIID subunit 3

Homo sapiens

UniProt Q5VWG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF3_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain c； PDBConstruct 1–929； UniProt 1–929

Transcription initiation factor TFIID subunit 11

Homo sapiens

UniProt Q15544

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF11_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain k； PDBConstruct 1–211； UniProt 1–211

Transcription initiation factor TFIID subunit 13

Homo sapiens

UniProt Q15543

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAF13_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain m； PDBConstruct 1–124； UniProt 1–124

DNA-directed RNA polymerase subunit

OrganismNot specified

UniProt A0A8D1DPV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1DPV6_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain o； PDBConstruct 1–1970； UniProt 1–1970

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt A0A4X1TVZ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TVZ5_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain p； PDBConstruct 1–1174； UniProt 78–1251

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt I3LCH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCH3_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain q； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit RPB4

OrganismNot specified

UniProt A0A481BYI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A481BYI6_PIG
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain r； PDBConstruct 1–142； UniProt 1–142

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt A0A4X1VTX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VTX4_PIG
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain s； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit F

OrganismNot specified

UniProt A0A4X1VEK9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VEK9_PIG
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain t； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt A0A4X1VKG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VKG7_PIG
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain u； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt I3LCB2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCB2_PIG
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain v； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain w； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt A0A493TD97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A493TD97_ANAPP
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain x； PDBConstruct 1–67； UniProt 1–67

DNA-directed RNA polymerase II subunit RPB11-a

OrganismNot specified

UniProt F1RKE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） RPB12 × 1 （A0A4X1TRS6） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RKE4_PIG
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain y； PDBConstruct 1–117； UniProt 1–117

RPB12

OrganismNot specified

UniProt A0A4X1TRS6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 48 DNA 2 RNA 1	CDK-activating kinase assembly factor MAT1 × 1 （P51948） General transcription factor IIH subunit 1 × 1 （P32780） General transcription factor IIH subunit 2 × 1 （Q13888） General transcription factor IIH subunit 3 × 1 （Q13889） General transcription factor IIH subunit 4 × 1 （Q92759） General transcription factor IIH subunit 5 × 1 （Q6ZYL4） General transcription and DNA repair factor IIH helicase subunit XPB × 1 （P19447） General transcription and DNA repair factor IIH helicase subunit XPD × 1 （P18074） Alpha-amanitin × 1 （P85421） RNA × 1 Transcription initiation factor TFIID subunit 1 × 1 （P21675） Transcription initiation factor TFIID subunit 2 × 1 （Q6P1X5） Transcription initiation factor TFIID subunit 4 × 2 （O00268） Transcription initiation factor TFIID subunit 5 × 2 （Q15542） Transcription initiation factor TFIID subunit 6 × 2 （P49848） Transcription initiation factor TFIID subunit 7 × 1 （Q15545） Transcription initiation factor TFIID subunit 8 × 1 （Q7Z7C8） Transcription initiation factor TFIID subunit 9 × 2 （Q16594） Transcription initiation factor TFIID subunit 10 × 2 （Q12962） Transcription initiation factor TFIID subunit 12 × 2 （Q16514） Transcription initiation factor IIA subunit 2 × 1 （P52657） TATA-box-binding protein × 1 （P20226） Transcription initiation factor IIA beta chain × 1 （P52655） Transcription initiation factor IIB × 1 （Q00403） General transcription factor IIF subunit 1 × 1 （P35269） General transcription factor IIF subunit 2 × 1 （P13984） General transcription factor IIE subunit 1 × 1 （P29083） Transcription initiation factor IIE subunit beta × 1 （P29084） non-template DNA × 1 template DNA × 1 Transcription initiation factor TFIID subunit 3 × 1 （Q5VWG9） Transcription initiation factor TFIID subunit 11 × 1 （Q15544） Transcription initiation factor TFIID subunit 13 × 1 （Q15543） DNA-directed RNA polymerase subunit × 1 （A0A8D1DPV6） DNA-directed RNA polymerase subunit beta × 1 （A0A4X1TVZ5） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit RPB4 × 1 （A0A481BYI6） DNA-directed RNA polymerase II subunit E × 1 （A0A4X1VTX4） DNA-directed RNA polymerase II subunit F × 1 （A0A4X1VEK9） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A493TD97） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） ZINC ION × 17 IRON/SULFUR CLUSTER × 1 MAGNESIUM ION × 1 ;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TRS6_PIG
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain z； PDBConstruct 1–58； UniProt 1–58

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8was
Deposition date deposition_date	2023-09-08
Structure title title	Structure of transcribing complex 9 (TC9), the initially transcribing complex with Pol II positioned 9nt downstream of TSS.
Keywords keywords	transcribing complex, de novo transcription initiation, initially transcribing complex (ITC), TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8was__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8was__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8was__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	98.58 Å
Rg (electron density)	98.41 Å
Total Rg	98.28 Å
Atom count	108702
Residues	13317
Excluded volume	1930600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8was__assembly_1__model_1`	51-meric （51）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (49)

Entity 1 Entity 1 polymer

Description description	CDK-activating kinase assembly factor MAT1
Molecular weight formula_weight	35874.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0
Atom count atom_count	108702

MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDAFSGLFWQPS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	General transcription factor IIH subunit 1
Molecular weight formula_weight	62116.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	General transcription factor IIH subunit 2
Molecular weight formula_weight	44482.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	General transcription factor IIH subunit 3
Molecular weight formula_weight	34416.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	General transcription factor IIH subunit 4
Molecular weight formula_weight	52245.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	General transcription factor IIH subunit 5
Molecular weight formula_weight	8060.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPB
Molecular weight formula_weight	89404.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	General transcription and DNA repair factor IIH helicase subunit XPD
Molecular weight formula_weight	87021.1 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Alpha-amanitin
Molecular weight formula_weight	939.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

IWGIGCNP

Entity 10 Entity 10 polymer

Description description	RNA
Molecular weight formula_weight	3034.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Z

XUCAACUUG

Entity 11 Entity 11 polymer

Description description	Transcription initiation factor TFIID subunit 1
Molecular weight formula_weight	212956.2 kDa
EC 编号 ec_number	2.3.1.48,2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITELTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPPPPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLRFLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESKFSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADENFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRWEDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRANTHIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMVSPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCGEGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSREREEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTTKDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCPLYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSATPEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	Transcription initiation factor TFIID subunit 2
Molecular weight formula_weight	137160.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSGTSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	Transcription initiation factor TFIID subunit 4
Molecular weight formula_weight	110221.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKPAGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQTPPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAGGPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGLPKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTASLGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPGSSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	Transcription initiation factor TFIID subunit 5
Molecular weight formula_weight	86932.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	72749.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 16 Entity 16 polymer

Description description	Transcription initiation factor TFIID subunit 7
Molecular weight formula_weight	40325.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 17 Entity 17 polymer

Description description	Transcription initiation factor TFIID subunit 8
Molecular weight formula_weight	34304.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 18 Entity 18 polymer

Description description	Transcription initiation factor TFIID subunit 9
Molecular weight formula_weight	29006.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 19 Entity 19 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21731.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 20 Entity 20 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	17948.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 21 Entity 21 polymer

Description description	Transcription initiation factor IIA subunit 2
Molecular weight formula_weight	12469.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 22 Entity 22 polymer

Description description	TATA-box-binding protein
Molecular weight formula_weight	37729.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 23 Entity 23 polymer

Description description	Transcription initiation factor IIA beta chain
Molecular weight formula_weight	41544.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 24 Entity 24 polymer

Description description	Transcription initiation factor IIB
Molecular weight formula_weight	34877.9 kDa
EC 编号 ec_number	2.3.1.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 25 Entity 25 polymer

Description description	General transcription factor IIF subunit 1
Molecular weight formula_weight	58343.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKGVDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 26 Entity 26 polymer

Description description	General transcription factor IIF subunit 2
Molecular weight formula_weight	28427.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQGEEKSD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 27 Entity 27 polymer

Description description	General transcription factor IIE subunit 1
Molecular weight formula_weight	49516.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTPEEKEAYIAMGQRMFEDLFE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 28 Entity 28 polymer

Description description	Transcription initiation factor IIE subunit beta
Molecular weight formula_weight	33106.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 29 Entity 29 polymer

Description description	non-template DNA
Molecular weight formula_weight	30617.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	X

AAGGGCGCCTATAAAAGGGGGTGGTTGTGAGTTCTTCTTCATCAACTTGGTCTACTTCGAGCCGAGCAGACGTGCCTACGGACCATGTCCGAAACTGAC

Entity 30 Entity 30 polymer

Description description	template DNA
Molecular weight formula_weight	30466.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

GTCAGTTTCGGACATGGTCCGTAGGCACGTCTGCTCGGCTCGAAGTAGACCAAGTTGATGAAGAAGAACTCACAACCACCCCCTTTTATAGGCGCCCTT

Entity 31 Entity 31 polymer

Description description	Transcription initiation factor TFIID subunit 3
Molecular weight formula_weight	103769.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLAPPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLGTPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 32 Entity 32 polymer

Description description	Transcription initiation factor TFIID subunit 11
Molecular weight formula_weight	23340.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 33 Entity 33 polymer

Description description	Transcription initiation factor TFIID subunit 13
Molecular weight formula_weight	14307.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 34 Entity 34 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	217420.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 35 Entity 35 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 36 Entity 36 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 37 Entity 37 polymer

Description description	DNA-directed RNA polymerase II subunit RPB4
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 38 Entity 38 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 39 Entity 39 polymer

Description description	DNA-directed RNA polymerase II subunit F
Molecular weight formula_weight	14477.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Entity 40 Entity 40 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 41 Entity 41 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 42 Entity 42 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 43 Entity 43 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 44 Entity 44 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11-a
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 45 Entity 45 polymer

Description description	RPB12
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 46 Entity 46 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 47 Entity 47 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 48 Entity 48 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 49 Entity 49 non-polymer

Description description	;[[(2~{S},3~{R},4~{S},5~{R})-5-(2-azanyl-6-oxidanylidene-3~{H}-purin-9-yl)-3-methoxy-4-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate ;
Molecular weight formula_weight	537.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	6.13 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	3757

Structure of transcribing complex 9 (TC9), the initially transcribing complex with Pol II positioned 9nt downstream of TSS.

1. Protein Identity and Related Structures Protein Identity & Related Structures

CDK-activating kinase assembly factor MAT1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription factor IIH subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH helicase subunit XPB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

General transcription and DNA repair factor IIH helicase subunit XPD

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Alpha-amanitin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription initiation factor TFIID subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer