8p4f

Structural insights into human co-transcriptional capping - structure 6

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB1_CRIGR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–1970； UniProt 1–1970

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt I3LGP4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LGP4_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–1174； UniProt 78–1251

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt I3LCH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCH3_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–275； UniProt 1–275

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt I3LSI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LSI7_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerases I, II, and III subunit RPABC2

OrganismNot specified

UniProt F1SKN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SKN8_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt I3LCB2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LCB2_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt A0A4X1VYD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VYD0_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–67； UniProt 1–67

DNA-directed RNA polymerase II subunit RPB11-a

OrganismNot specified

UniProt F1RKE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RKE4_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 1–117

RNA polymerase II subunit K

OrganismNot specified

UniProt I3LN51

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LN51_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–58； UniProt 1–58

Transcription elongation factor SPT4

Homo sapiens

UniProt P63272

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPT4H_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Y； PDBConstruct 1–117； UniProt 1–117

Transcription elongation factor SPT5

Homo sapiens

UniProt O00267

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPT5H_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Z； PDBConstruct 1–1087； UniProt 1–1087

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt A0A4X1VKG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） RNA polymerase II subunit D × 1 （A0A287ADR4） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VKG7_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain G； PDBConstruct 1–172； UniProt 1–172

RNA polymerase II subunit D

OrganismNot specified

UniProt A0A287ADR4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） ;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ; × 1 （Q8N1G2） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ADR4_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 43–184

;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ;

Homo sapiens

UniProt Q8N1G2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	RNA (29-MER) × 1 DNA-directed RNA polymerase II subunit RPB1 × 1 （P11414） DNA-directed RNA polymerase subunit beta × 1 （I3LGP4） DNA-directed RNA polymerase II subunit RPB3 × 1 （I3LCH3） DNA-directed RNA polymerase II subunit E × 1 （I3LSI7） DNA-directed RNA polymerases I, II, and III subunit RPABC2 × 1 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 1 （I3LCB2） DNA-directed RNA polymerase II subunit RPB9 × 1 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 1 （A0A4X1VYD0） DNA-directed RNA polymerase II subunit RPB11-a × 1 （F1RKE4） RNA polymerase II subunit K × 1 （I3LN51） DNA (38-MER) × 1 DNA (38-MER) × 1 Transcription elongation factor SPT4 × 1 （P63272） Transcription elongation factor SPT5 × 1 （O00267） DNA-directed RNA polymerase II subunit RPB7 × 1 （A0A4X1VKG7） RNA polymerase II subunit D × 1 （A0A287ADR4） 7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE × 1 ZINC ION × 8 MAGNESIUM ION × 1 S-ADENOSYLMETHIONINE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CMTR1_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain O； PDBConstruct 1–835； UniProt 1–835

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p4f
Deposition date deposition_date	2023-05-20
Structure title title	Structural insights into human co-transcriptional capping - structure 6
Keywords keywords	rna polymerase II, capping, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8p4f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8p4f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8p4f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.44 Å
Rg (electron density)	59.67 Å
Total Rg	59.61 Å
Atom count	43686
Residues	5312
Excluded volume	772590 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8p4f__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Description description	RNA (29-MER)
Molecular weight formula_weight	9368.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P
Atom count atom_count	43686

GAUCAAAAAGACAUACAUAAAGACCAGGC

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase II subunit RPB1
Molecular weight formula_weight	217450.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 4 Entity 4 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC2
Molecular weight formula_weight	14491.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14507.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MEPDGTYEPGIVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerase II subunit RPB11-a
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 11 Entity 11 polymer

Description description	RNA polymerase II subunit K
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 12 Entity 12 polymer

Description description	DNA (38-MER)
Molecular weight formula_weight	11762.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

AGTACTAGTATTCTAGTATTGAAAGTACTTGAGCTTGA

Entity 13 Entity 13 polymer

Description description	DNA (38-MER)
Molecular weight formula_weight	11628.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

TCAAGCTCAAGTACTTAAGCCTGGTCTATACTAGTACT

Entity 14 Entity 14 polymer

Description description	Transcription elongation factor SPT4
Molecular weight formula_weight	13210.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 15 Entity 15 polymer

Description description	Transcription elongation factor SPT5
Molecular weight formula_weight	121145.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEEEDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 16 Entity 16 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 17 Entity 17 polymer

Description description	RNA polymerase II subunit D
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 18 Entity 18 polymer

Description description	;Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 ;
Molecular weight formula_weight	95454.8 kDa
EC 编号 ec_number	2.1.1.57
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGKQHSSDSFDDAFKADSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYSQGRKDIVEASSQKGRRGLGLTLRGFDQELNVDWRDEPEPSACEQVSWFPECTTEIPDTQEMSDWMVVGKRKMIIEDETEFCGEELLHSVLQCKSVFDVLDGEEMRRARTRANPYEMIRGVFFLNRAAMKMANMDFVFDRMFTNPRDSYGKPLVKDREAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKGPNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENISAFRNFVLDNTDRKGVHFLMADGGFSVEGQENLQEILSKQLLLCQFLMALSIVRTGGHFICKTFDLFTPFSVGLVYLLYCCFERVCLFKPITSRPANSERYVVCKGLKVGIDDVRDYLFAVNIKLNQLRNTDSDVNLVVPLEVIKGDHEFTDYMIRSNESHCSLQIKALAKIHAFVQDTTLSEPRQAEIRKECLRLWGIPDQARVAPSSSDPKSKFFELIQGTEIDIFSYKPTLLTSKTLEKIRPVFDYRCMVSGSEQKFLIGLGKSQIYTWDGRQSDRWIKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHILDVLVLNGTDVREQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNEPWTMGFSKSFKKKFFYNKKTKDSTFDLPADSIAPFHICYYGRLFWEWGDGIRVHDSQKPQDQDKLSKEDVLSFIQMHRA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 19 Entity 19 non-polymer

Description description	7N-METHYL-8-HYDROGUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	539.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 21 Entity 21 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	S-ADENOSYLMETHIONINE
Molecular weight formula_weight	398.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	8p4fA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	8p4fA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	8p4fB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	8p4fK01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

▶

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	31423

Structural insights into human co-transcriptional capping - structure 6

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase II subunit RPB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB11-a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer