SAXSdb — 3mce

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nascent polypeptide-associated complex subunit alpha

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 81–133 Chain B； UniProt 81–133	Fragment：NAC domain (UNP RESIDUES 81-133)	IOD IODIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.3；289 K；0.2M potassium citrate tribasic monohydrate (pH 8.3), 20% (w/v) PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.40 Å R-free 0.277
2	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 81–133 Chain D； UniProt 81–133	Fragment：NAC domain (UNP RESIDUES 81-133)	IOD IODIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.3；289 K；0.2M potassium citrate tribasic monohydrate (pH 8.3), 20% (w/v) PEG 3350, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.40 Å R-free 0.277

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3MCE	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
28LN XBP1u-stalled RPL4 RNC in complex with NAC Deposited 2026-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 80 PDB declaration: 86-meric	Chain Bu 1–215（215 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY mmCIF provides none of the parsed conditions	Resolution 2.70 Å
3LKX Human nac dimerization domain Deposited 2010-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 84–136（53 aa） Fragment：UNP residues 84-136	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；285 K；PEG 6000, Sodium citrate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 285K	Resolution 2.50 Å R-free 0.253
3MCB Crystal structure of NAC domains of human nascent polypeptide-associated complex (NAC) Deposited 2010-03-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 79–132（54 aa） Fragment：NAC domain (UNP RESIDUES 79-132)	Not recorded	IOD IODIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；289 K；0.1M sodium citrate (pH 5.6), 0.1 M NaCl, 12% (w/v) PEG 4000, VAPOR DIFFUSION, temperature 289K	Resolution 1.90 Å R-free 0.247
7QWQ Ternary complex of ribosome nascent chain with SRP and NAC Deposited 2022-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 48 PDB declaration: 52-meric	Chain t 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 97 ZN ZINC ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.83 Å
7QWR Structure of the ribosome-nascent chain containing an ER signal sequence in complex with NAC Deposited 2022-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 45 PDB declaration: 48-meric	Chain t 1–215（215 aa）	Not recorded	ZN ZINC ION × 5 MG MAGNESIUM ION × 97	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å
7QWS Structure of ribosome translating beta-tubulin in complex with TTC5 and NAC Deposited 2022-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 46 PDB declaration: 49-meric	Chain t 1–215（215 aa）	Not recorded	ZN ZINC ION × 5 MG MAGNESIUM ION × 97	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
8P2K Ternary complex of translating ribosome, NAC and METAP1 Deposited 2023-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain Na 1–215（215 aa）	Not recorded	N ANY 5'-MONOPHOSPHATE NUCLEOTIDE × 73 SPD SPERMIDINE × 30 SPM SPERMINE × 3 MG MAGNESIUM ION × 420 UNX UNKNOWN LIGAND × 312 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 AAC ACETYLAMINO-ACETIC ACID × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å
9F1B Mammalian ternary complex of a translating 80S ribosome, NAC and NatA/E Deposited 2024-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Ct 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 420 ZN ZINC ION × 8 UNX UNKNOWN LIGAND × 306 IHP INOSITOL HEXAKISPHOSPHATE × 1 SPD SPERMIDINE × 30 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.01 Å
9F1C Mammalian quaternary complex of a translating 80S ribosome, NAC, MetAP1 and NatA/E Deposited 2024-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 84 PDB declaration: 90-meric	Chain Ct 1–215（215 aa）	Not recorded	UNX UNKNOWN LIGAND × 277 MG MAGNESIUM ION × 420 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 SPD SPERMIDINE × 30 SPM SPERMINE × 3 ZN ZINC ION × 8 IHP INOSITOL HEXAKISPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.78 Å
9F1D Mammalian quaternary complex of a translating 80S ribosome, NAC, MetAP1 and NatA/E-HYPK Deposited 2024-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 85 PDB declaration: 91-meric	Chain Ct 1–215（215 aa）	Not recorded	UNX UNKNOWN LIGAND × 295 SPD SPERMIDINE × 30 MG MAGNESIUM ION × 420 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.26 Å
9FQ0 Human NatA-NAC-MAP1 80S ribosome complex Deposited 2024-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain A 1–215（215 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.67 Å
9I2D NMT1-NAC bound human RNC with 10 amino acid ARF1-linker Deposited 2025-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.19 Å
9I2E NMT1-NAC bound human ribosome (combined translational states) Deposited 2025-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 81 PDB declaration: 86-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 256 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9MR4 NAC: Ribosome nascent chain complex(Oxa1L) Deposited 2025-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 78 PDB declaration: 84-meric	Chain EG 1–215（215 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 285	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.65 Å
9NDP Structure of stalled ribosome and nascent chain in complex with NMT2 and NAC Deposited 2025-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 81 PDB declaration: 87-meric	Chain EG 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 296 ZN ZINC ION × 6 COA COENZYME A × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.82 Å
9QLO NMT1-NAC bound human RNC with full length ARF1 - State 1 Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 G3D GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.47 Å
9QLP NMT1-NAC bound human RNC with full length ARF1 - State 2 Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 G3D GUANOSINE-3'-MONOPHOSPHATE-5'-DIPHOSPHATE × 1 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.75 Å
9QLQ NMT1-NAC bound human RNC with full length ARF1 - alternative State Deposited 2025-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.57 Å
9QQA Ternary complex of translating ribosome, NAC and NMT1 Deposited 2025-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 81 PDB declaration: 86-meric	Chain Nt 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 407 UNX UNKNOWN LIGAND × 187 SPD SPERMIDINE × 30 SPM SPERMINE × 3 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.80 Å
9QQB Quaternary complex of a translating ribosome, NAC, NMT1, and NatA Deposited 2025-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 84 PDB declaration: 89-meric	Chain Nt 1–215（215 aa）	Not recorded	SPD SPERMIDINE × 30 SPM SPERMINE × 3 MG MAGNESIUM ION × 412 UNX UNKNOWN LIGAND × 168 ZN ZINC ION × 8 IHP INOSITOL HEXAKISPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.43 Å
9S3B NMT1-NAC bound human RNC with 58 amino acid ARF1-linker - State 1 Deposited 2025-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.38 Å
9S3C NMT1-NAC bound human RNC with 58 amino acid ARF1-linker - State 2 Deposited 2025-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 82 PDB declaration: 88-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.42 Å
9S3D NAC bound human RNC with 58 amino acid ARF1-linker Deposited 2025-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 81 PDB declaration: 87-meric	Chain NA 1–215（215 aa）	Not recorded	MG MAGNESIUM ION × 191 ZN ZINC ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.32 Å
9SYR Human quaternary complex of a translating 80S ribosome, NAC, MetAP1 and NatD Deposited 2025-10-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 80 PDB declaration: 86-meric	Chain Na 1–215（215 aa）	Not recorded	ZN ZINC ION × 10 COA COENZYME A × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.55 Å

24 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NACA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–61； UniProt 81–133 Author chain B； PDBConstruct 9–61； UniProt 81–133 Author chain C； PDBConstruct 9–61； UniProt 81–133 Author chain D； PDBConstruct 9–61； UniProt 81–133

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3mce
Deposition date deposition_date	2010-03-29
Structure title title	Crystal structure of the NAC domain of alpha subunit of nascent polypeptide-associated complex(NAC)
Keywords keywords	beta-barrel like structure, NAC, homodimer, Chaperone; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.45 Å
Radius of gyration Rg (electron density) rg_electron	20.15 Å
Forward intensity I(0) i0	12900900.00
Molecular weight molecular_weight	26830.0 kDa
Excluded volume excluded_volume	33428 Å³
Envelope volume envelope_volume	39523 Å³
Hydration-shell volume shell_volume	17508 Å³
Envelope diameter envelope_diameter	76.5 Å
Shell Rg shell_rg	25.68 Å
Envelope Rg envelope_rg	20.56 Å
Shape Rg shape_rg	19.94 Å
Total Rg total_rg	21.58 Å
Total atoms total_atoms	1831
Residues n_residues	233
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	75.6 Å
Rg (real space) rg_real	21.58 Å
Rg uncertainty (real space) rg_real_error	0.61 Å
I(0) (real space) i0_real	1.2900e+07
I(0) uncertainty (real space) i0_real_error	1.7880e+05
Rg (reciprocal space) rg_reciprocal	21.56 Å
I(0) (reciprocal space) i0_reciprocal	12900000.0000
Solution quality estimate total_estimate	0.8321
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.2 Å
Skewness Skewness skewness	0.506
Kurtosis Kurtosis kurtosis	-0.202
Angular range angular_range	— – 0.3700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1491000.0000
Real-space data points n_real_points	69
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.677; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.838; Smooth: 0.945

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Nascent polypeptide-associated complex subunit alpha
Molecular weight formula_weight	6705.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	1884

GPLGSPEFSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	IODIDE ION
Molecular weight formula_weight	126.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	53

▶

8. Citations (1)

▶

Unit-cell length a length_a	54.592 Å
Unit-cell length b length_b	59.605 Å
Unit-cell length c length_c	69.130 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.396 Å
Low-resolution limit resolution_low	29.901 Å
R factor r_factor	0.2500
R_work r_work	0.2470
R_free r_free	0.2770

fit	/app/data/saxs_computation/mc/3mce/3mce.fit
pddf	/app/data/pr_computation/mc/3mce/3mce.pr.out
profile	/app/data/saxs_computation/mc/3mce/3mce.dat

Crystal structure of the NAC domain of alpha subunit of nascent polypeptide-associated complex(NAC)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nascent polypeptide-associated complex subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction