SAXSdb — 3mtu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	CHLORIDE ION × 2 1,2-ETHANEDIOL × 9 ETHANOL × 7 water × 6	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	CHLORIDE ION × 2 1,2-ETHANEDIOL × 9 ETHANOL × 7 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TPM1_CHICK
Isoform	P04268-7
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 5–32； UniProt 2–29 Author chain B； PDBConstruct 5–32； UniProt 2–29 Author chain C； PDBConstruct 5–32； UniProt 2–29 Author chain D； PDBConstruct 5–32； UniProt 2–29 Author chain E； PDBConstruct 50–76； UniProt 257–283 Author chain F； PDBConstruct 50–76； UniProt 257–283

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

Homo sapiens

UniProt Q15691

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain × 2 （P04268,P13848） CHLORIDE ION × 2 1,2-ETHANEDIOL × 9 ETHANOL × 7 water × 6	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain × 1 （P04268,P13848） CHLORIDE ION × 2 1,2-ETHANEDIOL × 9 ETHANOL × 7 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MARE1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 34–75； UniProt 216–257 Author chain B； PDBConstruct 34–75； UniProt 216–257 Author chain C； PDBConstruct 34–75； UniProt 216–257 Author chain D； PDBConstruct 34–75； UniProt 216–257

Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain

Gallus gallus

UniProt P13848

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1 × 4 （P04268,Q15691） CHLORIDE ION × 2 1,2-ETHANEDIOL × 9 ETHANOL × 7 water × 6	Consistent with protein count
2	Insufficient information	Heteromer	Protein 5	Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1 × 4 （P04268,Q15691） CHLORIDE ION × 2 1,2-ETHANEDIOL × 9 ETHANOL × 7 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCAF_BPPH2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 5–49； UniProt 2–46 Author chain F； PDBConstruct 5–49； UniProt 2–46

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3mtu
Deposition date deposition_date	2010-04-30
Structure title title	Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle
Keywords keywords	tropomysoin, overlap complex, coiled-coils, Contractile Protein; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3mtu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3mtu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3mtu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.51 Å
Rg (electron density)	39.22 Å
Total Rg	38.35 Å
Atom count	3379
Residues	392
Excluded volume	60204 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3mtu__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3mtu__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1
Molecular weight formula_weight	8713.4 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3767

GASMDAIKKKMQMLKLDKENALDRAEQAEADKDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain
Molecular weight formula_weight	8956.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

GGSGPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEENLNMHQMLDQTLLELNNM

Source Source

Source organism organism	Gallus gallus
Common name common_name	Chicken
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 non-polymer

Description description	ETHANOL
Molecular weight formula_weight	46.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	347

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3mtue1
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.24 — Head morphogenesis protein gp7
Family Family family	h.1.24.1 — Head morphogenesis protein gp7

Domain ID domain_id	d3mtue2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3mtuf1
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.24 — Head morphogenesis protein gp7
Family Family family	h.1.24.1 — Head morphogenesis protein gp7

Domain ID domain_id	d3mtuf2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (6 domains)

Domain ID domain_id	3mtuA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	3mtuB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	3mtuC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	3mtuD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	3mtuE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	400 —

Domain ID domain_id	3mtuF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	400 —

▶

Unit-cell length a length_a	89.131 Å
Unit-cell length b length_b	285.328 Å
Unit-cell length c length_c	43.457 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	C 2 2 2
Space-group number int_tables_number	21
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	29.870 Å
R factor r_factor	0.2030
R_work r_work	0.2010
R_free r_free	0.2411

Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3mtu__assembly_1__model_1

3mtu__assembly_1__model_1 | I(q)

3mtu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid assembly scaffolding protein,Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3mtu__assembly_1__model_1

3mtu__assembly_1__model_1 | I(q)

3mtu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

7. Citations (1)