SAXSdb — 3sl9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Catenin beta-1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	B-cell CLL/lymphoma 9 protein × 1 （O00512） 1,2-ETHANEDIOL × 4 DI(HYDROXYETHYL)ETHER × 2 IMIDAZOLE × 2 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	B-cell CLL/lymphoma 9 protein × 1 （O00512） 1,2-ETHANEDIOL × 3 DI(HYDROXYETHYL)ETHER × 2 IMIDAZOLE × 1 GLYCEROL × 2 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	B-cell CLL/lymphoma 9 protein × 1 （O00512） 1,2-ETHANEDIOL × 4 DI(HYDROXYETHYL)ETHER × 1 IMIDAZOLE × 1 GLYCEROL × 2 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	B-cell CLL/lymphoma 9 protein × 1 （O00512） IMIDAZOLE × 3 GLYCEROL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTNB1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–167； UniProt 141–305 Author chain B； PDBConstruct 3–167； UniProt 141–305 Author chain E； PDBConstruct 3–167； UniProt 141–305 Author chain G； PDBConstruct 3–167； UniProt 141–305

B-cell CLL/lymphoma 9 protein

Homo sapiens

UniProt O00512

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Catenin beta-1 × 1 （P35222） 1,2-ETHANEDIOL × 4 DI(HYDROXYETHYL)ETHER × 2 IMIDAZOLE × 2 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Catenin beta-1 × 1 （P35222） 1,2-ETHANEDIOL × 3 DI(HYDROXYETHYL)ETHER × 2 IMIDAZOLE × 1 GLYCEROL × 2 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Catenin beta-1 × 1 （P35222） 1,2-ETHANEDIOL × 4 DI(HYDROXYETHYL)ETHER × 1 IMIDAZOLE × 1 GLYCEROL × 2 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Catenin beta-1 × 1 （P35222） IMIDAZOLE × 3 GLYCEROL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCL9_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 3–55； UniProt 344–396 Author chain D； PDBConstruct 3–55； UniProt 344–396 Author chain F； PDBConstruct 3–55； UniProt 344–396 Author chain H； PDBConstruct 3–55； UniProt 344–396

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3sl9
Deposition date deposition_date	2011-06-24
Structure title title	X-ray structure of Beta catenin in complex with Bcl9
Keywords keywords	Armadillo repeat, components of the Wnt signaling pathway, Beta catenin, SIGNALING PROTEIN, PROTEIN BINDING; SIGNALING PROTEIN, PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3sl9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3sl9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3sl9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.41 Å
Rg (electron density)	17.69 Å
Total Rg	18.63 Å
Atom count	1455
Residues	191
Excluded volume	26126 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3sl9__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3sl9__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3sl9__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3sl9__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Catenin beta-1
Molecular weight formula_weight	18176.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,G
Atom count atom_count	5813

GSNYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	B-cell CLL/lymphoma 9 protein
Molecular weight formula_weight	6171.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,F,H

MALGENPDGLSQEQLEHRERSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 4 Entity 4 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 non-polymer

Description description	IMIDAZOLE
Molecular weight formula_weight	69.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 6 Entity 6 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	152

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3sl9A00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

Domain ID domain_id	3sl9B00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

Domain ID domain_id	3sl9E00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

Domain ID domain_id	3sl9G00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

▶

Unit-cell length a length_a	160.890 Å
Unit-cell length b length_b	80.700 Å
Unit-cell length c length_c	87.940 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	102.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	29.430 Å
R factor r_factor	0.1970
R_work r_work	0.1940
R_free r_free	0.2490

X-ray structure of Beta catenin in complex with Bcl9

1. Protein Identity and Related Structures Protein Identity & Related Structures

Catenin beta-1

State in the Current Structure

Other States of the Same Protein in the Database

B-cell CLL/lymphoma 9 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3sl9__assembly_1__model_1

3sl9__assembly_1__model_1 | I(q)

3sl9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

X-ray structure of Beta catenin in complex with Bcl9

1. Protein Identity and Related Structures Protein Identity & Related Structures

Catenin beta-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

B-cell CLL/lymphoma 9 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3sl9__assembly_1__model_1

3sl9__assembly_1__model_1 | I(q)

3sl9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)