SAXSdb — 3tix

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3

Schizosaccharomyces pombe

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Chromo domain-containing protein 1 × 1 （Q10103） CHLORIDE ION × 4 POTASSIUM ION × 1 water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Chromo domain-containing protein 1 × 1 （Q10103） CHLORIDE ION × 4 POTASSIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAS3_SCHPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 133–207； UniProt 9–83 Author chain C； PDBConstruct 133–207； UniProt 9–83

Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3

Schizosaccharomyces pombe

UniProt Q12306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Chromo domain-containing protein 1 × 1 （Q10103） CHLORIDE ION × 4 POTASSIUM ION × 1 water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Chromo domain-containing protein 1 × 1 （Q10103） CHLORIDE ION × 4 POTASSIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMT3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 37–132； UniProt 3–98 Author chain C； PDBConstruct 37–132； UniProt 3–98

Chromo domain-containing protein 1

Schizosaccharomyces pombe (strain 972 / ATCC 24843)

UniProt Q10103

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3 × 1 （O94687,Q12306） CHLORIDE ION × 4 POTASSIUM ION × 1 water × 2	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3 × 1 （O94687,Q12306） CHLORIDE ION × 4 POTASSIUM ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CHP1_SCHPO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–458； UniProt 504–960 Author chain D； PDBConstruct 2–458； UniProt 504–960

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3tix
Deposition date deposition_date	2011-08-22
Structure title title	Crystal structure of the Chp1-Tas3 complex core
Keywords keywords	;PIN, Rossmann fold, SPOC, alpha-helical hairpin, heterochromatin, silencing, RITS, RNAi, Argonaute, ClrC, RDRC, Nucleus, GENE REGULATION-PROTEIN BINDING complex ;; GENE REGULATION/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3tix__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3tix__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3tix__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.18 Å
Rg (electron density)	34.35 Å
Total Rg	34.57 Å
Atom count	4654
Residues	574
Excluded volume	83689 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3tix__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3tix__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3
Molecular weight formula_weight	23333.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	9309

MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKTGSLQDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLTFLYDGIEIQADQTPEDLDMEDNDIIEAHREQIGGLPSLPFLACISDFPENHGTSRRSATVSLERVHELFTEHWLSNLKNRREKRQELAEEAVYCRSEMLSQRKLLAAVD

Source Source

Source organism organism	Schizosaccharomyces pombe
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Chromo domain-containing protein 1
Molecular weight formula_weight	52362.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MISESEDLSSASTLSDYFRFVLRVGKSLYYAGELSFDISKLKAETEHQQLLRSLVSCKQVDVLRFVTSQYLEVFGTCLTKVLSGSLCIRSDVDMTHFKNILNRGNGAGIVLGSNYTLLLFTEDNNALMNLYDCQGQSNSPFWMVIFEPLESILVEWSAKNLRPKKPYHKSQSYLSYLLQLGHIDLHKIGAFQATQILIVSKQPSPEAEELEDTFREAAIPTFRGLEIPESLFLSQNVFVFLNVSLEDDFDQLQFLTLAKRKSCKFFLFGLSLPLKSPNDSHVGTDFKKNNEPLDKLTYSQYLRPMFPKGGVVSVTLSALIKTPRLLELISPFLEIKKDSWILILPPSIVDMVKSYFVTNNPDKSLLEIQNLLNTLQRYLTNPALKNVTLYQDWDIVIDDSADVSLASTLQLYQKKNYDKYRRFVLIHELKNELTPVNGLDIVDYDEFKETFMRAIGLK

Source Source

Source organism organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Common name common_name	Fission yeast
NCBI taxonomy ID ncbi_taxonomy_id	284812
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	26

▼

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

Domain ID domain_id	3tixA01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	3tixA02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	1690 —

Domain ID domain_id	3tixB01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	290 — Ku70; Chain: A; Domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3tixB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3tixB03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11490 —

Domain ID domain_id	3tixC01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	3tixC02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	1690 —

Domain ID domain_id	3tixD01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	290 — Ku70; Chain: A; Domain 2
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	3tixD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1010 — Cobalt-precorrin-4 Transmethylase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	3tixD03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11490 —

▶

Unit-cell length a length_a	104.880 Å
Unit-cell length b length_b	172.200 Å
Unit-cell length c length_c	198.680 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	65.063 Å
R factor r_factor	0.2123
R_work r_work	0.2107
R_free r_free	0.2427

Crystal structure of the Chp1-Tas3 complex core

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3

State in the Current Structure

Other States of the Same Protein in the Database

Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3

State in the Current Structure

Other States of the Same Protein in the Database

Chromo domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3tix__assembly_1__model_1

3tix__assembly_1__model_1 | I(q)

3tix__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

7. Citations (1)

Crystal structure of the Chp1-Tas3 complex core

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquitin-like protein SMT3,RNA-induced transcriptional silencing complex protein tas3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromo domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3tix__assembly_1__model_1

3tix__assembly_1__model_1 | I(q)

3tix__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

7. Citations (1)