SAXSdb — 4i5u

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimeric cel6A

Trichoderma reesei

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ACETATE ION × 2 1,2-ETHANEDIOL × 10 TETRAETHYLENE GLYCOL × 1 TRIETHYLENE GLYCOL × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GUX2_HYPJE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 46–219； UniProt 158–331 Author chain A； PDBConstruct 312–358； UniProt 425–471

Chimeric cel6A

Trichoderma reesei

UniProt Q5G2D4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ACETATE ION × 2 1,2-ETHANEDIOL × 10 TETRAETHYLENE GLYCOL × 1 TRIETHYLENE GLYCOL × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5G2D4_9PEZI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 220–311； UniProt 339–430

Chimeric cel6A

Trichoderma reesei

UniProt Q9C1S9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	ACETATE ION × 2 1,2-ETHANEDIOL × 10 TETRAETHYLENE GLYCOL × 1 TRIETHYLENE GLYCOL × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GUX6_HUMIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–45； UniProt 117–161

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4i5u
Deposition date deposition_date	2012-11-29
Structure title title	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A
Keywords keywords	cellobiohydrolase, chimera protein, glycoside hydrolase, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4i5u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4i5u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4i5u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.27 Å
Rg (electron density)	19.12 Å
Total Rg	20.13 Å
Atom count	2820
Residues	358
Excluded volume	49906 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4i5u__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Chimeric cel6A
Molecular weight formula_weight	39740.1 kDa
EC 编号 ec_number	3.2.1.91
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3236

GNPFEGVQLWANNYYRSEVHTLAIPQITDPALRAAASAAAEVPSFLWLDTLDKTPLMEQTLADIRTANKNGGNYAGQFVVYDLPDRDCAALASNGEYSIADGGVAKYKNYIDTIRQIVVEYSDIRTLLVIEPDSLANLVTNLGTPKCANAQSAYLECINYAVTQLNLPNVAMYLDAGHAGWLGWPANLDPAAQLFANVYKNASSPRALRGLATNVANYNAWSIASPPPYTSPNPNYDEKHYIEAFAPLLRNQGFDAKFIVDTGRNGKQPTGQLEWGHWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDPSAPRFDPHCALPDALQPAPQAGAWFQAYFVQLLTNANPSFLHHHHHH

Source Source

Source organism organism	Trichoderma reesei
Common name common_name	Trichoderma reesei, Trichoderma reesei
NCBI taxonomy ID ncbi_taxonomy_id	51453
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 4 Entity 4 non-polymer

Description description	TETRAETHYLENE GLYCOL
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	TRIETHYLENE GLYCOL
Molecular weight formula_weight	150.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	327

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d4i5ua_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.6 — 7-stranded beta/alpha barrel
Superfamily Superfamily superfamily	c.6.1 — Glycosyl hydrolases family 6, cellulases
Family Family family	c.6.1.1 — Glycosyl hydrolases family 6, cellulases

CATH v4.4 (1 domains)

Domain ID domain_id	4i5uA00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	40 — 1, 4-beta cellobiohydrolase

▶

Unit-cell length a length_a	158.599 Å
Unit-cell length b length_b	45.414 Å
Unit-cell length c length_c	58.194 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.47 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.220 Å
Low-resolution limit resolution_low	35.308 Å
R factor r_factor	0.1434
R_work r_work	0.1426
R_free r_free	0.1584

Crystal structure of a fungal chimeric cellobiohydrolase Cel6A

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimeric cel6A

State in the Current Structure

Other States of the Same Protein in the Database

Chimeric cel6A

State in the Current Structure

Other States of the Same Protein in the Database

Chimeric cel6A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4i5u__assembly_1__model_1

4i5u__assembly_1__model_1 | I(q)

4i5u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of a fungal chimeric cellobiohydrolase Cel6A

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimeric cel6A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chimeric cel6A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chimeric cel6A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4i5u__assembly_1__model_1

4i5u__assembly_1__model_1 | I(q)

4i5u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)