4n9f

Crystal structure of the Vif-CBFbeta-CUL5-ElOB-ElOC pentameric complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cullin-5

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 5	Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CUL5_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 3； PDBConstruct 2–311； UniProt 12–321 Author chain 9； PDBConstruct 2–311； UniProt 12–321 Author chain C； PDBConstruct 2–311； UniProt 12–321 Author chain I； PDBConstruct 2–311； UniProt 12–321 Author chain O； PDBConstruct 2–311； UniProt 12–321 Author chain U； PDBConstruct 2–311； UniProt 12–321 Author chain V； PDBConstruct 2–311； UniProt 12–321 Author chain f； PDBConstruct 2–311； UniProt 12–321 Author chain l； PDBConstruct 2–311； UniProt 12–321 Author chain r； PDBConstruct 2–311； UniProt 12–321 Author chain w； PDBConstruct 2–311； UniProt 12–321 Author chain x； PDBConstruct 2–311； UniProt 12–321

Transcription elongation factor B polypeptide 1

Homo sapiens

UniProt Q15369

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ELOC_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 5； PDBConstruct 1–96； UniProt 17–112 Author chain B； PDBConstruct 1–96； UniProt 17–112 Author chain E； PDBConstruct 1–96； UniProt 17–112 Author chain K； PDBConstruct 1–96； UniProt 17–112 Author chain Q； PDBConstruct 1–96； UniProt 17–112 Author chain T； PDBConstruct 1–96； UniProt 17–112 Author chain Y； PDBConstruct 1–96； UniProt 17–112 Author chain Z； PDBConstruct 1–96； UniProt 17–112 Author chain h； PDBConstruct 1–96； UniProt 17–112 Author chain n； PDBConstruct 1–96； UniProt 17–112 Author chain t； PDBConstruct 1–96； UniProt 17–112 Author chain z； PDBConstruct 1–96； UniProt 17–112

Transcription elongation factor B polypeptide 2

Homo sapiens

UniProt Q15370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Core-binding factor subunit beta × 1 （Q13951） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ELOB_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 1–102； UniProt 1–102 Author chain D； PDBConstruct 1–102； UniProt 1–102 Author chain H； PDBConstruct 1–102； UniProt 1–102 Author chain J； PDBConstruct 1–102； UniProt 1–102 Author chain P； PDBConstruct 1–102； UniProt 1–102 Author chain W； PDBConstruct 1–102； UniProt 1–102 Author chain X； PDBConstruct 1–102； UniProt 1–102 Author chain e； PDBConstruct 1–102； UniProt 1–102 Author chain g； PDBConstruct 1–102； UniProt 1–102 Author chain m； PDBConstruct 1–102； UniProt 1–102 Author chain s； PDBConstruct 1–102； UniProt 1–102 Author chain y； PDBConstruct 1–102； UniProt 1–102

Core-binding factor subunit beta

Homo sapiens

UniProt Q13951

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Virion infectivity factor × 1 （Q72499） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PEBB_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 0； PDBConstruct 1–170； UniProt 1–170 Author chain 6； PDBConstruct 1–170； UniProt 1–170 Author chain F； PDBConstruct 1–170； UniProt 1–170 Author chain L； PDBConstruct 1–170； UniProt 1–170 Author chain N； PDBConstruct 1–170； UniProt 1–170 Author chain R； PDBConstruct 1–170； UniProt 1–170 Author chain a； PDBConstruct 1–170； UniProt 1–170 Author chain c； PDBConstruct 1–170； UniProt 1–170 Author chain i； PDBConstruct 1–170； UniProt 1–170 Author chain k； PDBConstruct 1–170； UniProt 1–170 Author chain o； PDBConstruct 1–170； UniProt 1–170 Author chain u； PDBConstruct 1–170； UniProt 1–170

Virion infectivity factor

Human immunodeficiency virus 1

UniProt Q72499

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 5	Cullin-5 × 1 （Q93034） Transcription elongation factor B polypeptide 1 × 1 （Q15369） Transcription elongation factor B polypeptide 2 × 1 （Q15370） Core-binding factor subunit beta × 1 （Q13951） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72499_9HIV1
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 1； PDBConstruct 1–176； UniProt 1–176 Author chain 2； PDBConstruct 1–176； UniProt 1–176 Author chain 7； PDBConstruct 1–176； UniProt 1–176 Author chain G； PDBConstruct 1–176； UniProt 1–176 Author chain M； PDBConstruct 1–176； UniProt 1–176 Author chain S； PDBConstruct 1–176； UniProt 1–176 Author chain b； PDBConstruct 1–176； UniProt 1–176 Author chain d； PDBConstruct 1–176； UniProt 1–176 Author chain j； PDBConstruct 1–176； UniProt 1–176 Author chain p； PDBConstruct 1–176； UniProt 1–176 Author chain q； PDBConstruct 1–176； UniProt 1–176 Author chain v； PDBConstruct 1–176； UniProt 1–176

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4n9f
Deposition date deposition_date	2013-10-21
Structure title title	Crystal structure of the Vif-CBFbeta-CUL5-ElOB-ElOC pentameric complex
Keywords keywords	Zinc Finger motif, stabilize VIf interaction with CUL5, CUL5, TRANSCRIPTION-VIRAL PROTEIN complex, LIGASE-VIRAL PROTEIN complex; LIGASE/VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4n9f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4n9f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4n9f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.34 Å
Rg (electron density)	35.61 Å
Total Rg	36.06 Å
Atom count	6505
Residues	799
Excluded volume	115680 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4n9f__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4n9f__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4n9f__assembly_3__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4n9f__assembly_4__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4n9f__assembly_5__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4n9f__assembly_6__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4n9f__assembly_7__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4n9f__assembly_8__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4n9f__assembly_9__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`4n9f__assembly_10__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`4n9f__assembly_11__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`4n9f__assembly_12__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Cullin-5
Molecular weight formula_weight	36386.8 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,C,I,O,V,f,l,r,x,3,9,w
Atom count atom_count	77274

ASLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Transcription elongation factor B polypeptide 1
Molecular weight formula_weight	10843.4 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,E,K,Q,Z,h,n,t,z,5,T,B

MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Transcription elongation factor B polypeptide 2
Molecular weight formula_weight	11488.0 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,D,J,P,W,g,m,s,y,4,e,H

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Core-binding factor subunit beta
Molecular weight formula_weight	20272.6 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,F,L,R,c,i,o,u,0,6,k,N

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Virion infectivity factor
Molecular weight formula_weight	20982.2 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,G,M,S,d,j,p,v,1,7,q,2

MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPKISSEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPDLADQLIHLHYFDCFSESAIRNTILGRIVSPRCEYQAGHNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNK

Source Source

Source organism organism	Human immunodeficiency virus 1
NCBI taxonomy ID ncbi_taxonomy_id	11676
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	12

▼

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

Domain ID domain_id	4n9f000
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9f301
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9f302
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9f400
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9f500
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9f600
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9f901
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9f902
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fD00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fE00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fF00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fH00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fI01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fI02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fJ00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fL00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fN00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fO01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fO02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fP00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fQ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fR00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fT00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fU01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fU02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fV01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fV02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fW00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fX00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fY00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fZ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fa00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fc00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fe00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9ff01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9ff02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fg00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fh00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fi00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fk00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fl01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fl02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fm00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fn00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fo00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fr01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fr02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fs00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9ft00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	4n9fu00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	250 — Polyomavirus Enhancer Binding Protein 2; Chain: A;
Homologous superfamily homologous superfamily	10 — Core binding factor, beta subunit

Domain ID domain_id	4n9fw01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fw02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fx01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fx02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1310 — 5 helical Cullin repeat like
Homologous superfamily homologous superfamily	10 — Cullin Repeats

Domain ID domain_id	4n9fy00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	90 — Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1

Domain ID domain_id	4n9fz00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

▶

Unit-cell length a length_a	103.925 Å
Unit-cell length b length_b	204.002 Å
Unit-cell length c length_c	247.866 Å
Unit-cell angle α angle_alpha	65.51 °
Unit-cell angle β angle_beta	90.28 °
Unit-cell angle γ angle_gamma	90.50 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	49.535 Å
R factor r_factor	0.2648
R_work r_work	0.2617
R_free r_free	0.3238

Crystal structure of the Vif-CBFbeta-CUL5-ElOB-ElOC pentameric complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cullin-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription elongation factor B polypeptide 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription elongation factor B polypeptide 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Core-binding factor subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Virion infectivity factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4n9f__assembly_1__model_1

4n9f__assembly_1__model_1 | I(q)

4n9f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 non-polymer

6. Fold Classification (SCOP + CATH) 60 domains

CATH v4.4 (60 domains)

7. Citations (1)