SAXSdb — 4ons

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Catenin alpha-2

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 18–264	Fragment：beta-catenin binding domain, UNP residues 18-264	Catenin beta-1 × 1 （Q02248）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.2；283 K；100mM Tris-Cl, 22% polyethylene glycol monomethryl ether, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 283K	Resolution 2.80 Å R-free 0.264
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 18–264	Fragment：beta-catenin binding domain, UNP residues 18-264	Catenin beta-1 × 1 （Q02248）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.2；283 K；100mM Tris-Cl, 22% polyethylene glycol monomethryl ether, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 283K	Resolution 2.80 Å R-free 0.264

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4ONS	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4K1O Crystal structure of the alphaN-catenin actin-binding domain Deposited 2013-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 651–905（255 aa） Fragment：C-terminal actin-binding domain	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；277 K；0.1M HEPES, pH 7.0, 1.6 M (NH4)2SO4, 0.2 M NaCl,and 0.1M K/Na tartate, vapor diffusion, temperature 277K	Resolution 2.60 Å R-free 0.231
4K1O Crystal structure of the alphaN-catenin actin-binding domain Deposited 2013-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 651–905（255 aa） Fragment：C-terminal actin-binding domain	Not recorded	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；277 K；0.1M HEPES, pH 7.0, 1.6 M (NH4)2SO4, 0.2 M NaCl,and 0.1M K/Na tartate, vapor diffusion, temperature 277K	Resolution 2.60 Å R-free 0.231
4P9T Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin Deposited 2014-04-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 13–261（249 aa） Fragment：UNP residues 13-261	Not recorded	IOD IODIDE ION × 5 EDO 1,2-ETHANEDIOL × 3 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG3350, 0.1 M Bis-Tris propane (pH 6.5), 0.2 M Sodium iodide	Resolution 2.50 Å R-free 0.234
4P9T Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin Deposited 2014-04-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 13–261（249 aa） Fragment：UNP residues 13-261	Not recorded	IOD IODIDE ION × 5 EDO 1,2-ETHANEDIOL × 3 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG3350, 0.1 M Bis-Tris propane (pH 6.5), 0.2 M Sodium iodide	Resolution 2.50 Å R-free 0.234
4P9T Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin Deposited 2014-04-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 13–261（249 aa） Fragment：UNP residues 13-261	Not recorded	IOD IODIDE ION × 5 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG3350, 0.1 M Bis-Tris propane (pH 6.5), 0.2 M Sodium iodide	Resolution 2.50 Å R-free 0.234
4P9T Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin Deposited 2014-04-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 13–261（249 aa） Fragment：UNP residues 13-261	Not recorded	IOD IODIDE ION × 5 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；PEG3350, 0.1 M Bis-Tris propane (pH 6.5), 0.2 M Sodium iodide	Resolution 2.50 Å R-free 0.234
5XFL Crystal structure of the force-sensing device region of alpha N-catenin Deposited 2017-04-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 260–632（373 aa） Fragment：UNP residues 260-632	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；277 K；100MM HEPES, 20% PEG3350, 200MM POTASSIUM FORMATE, PH 7.0, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 277K	Resolution 2.45 Å R-free 0.267
5XFL Crystal structure of the force-sensing device region of alpha N-catenin Deposited 2017-04-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 260–632（373 aa） Fragment：UNP residues 260-632	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；277 K；100MM HEPES, 20% PEG3350, 200MM POTASSIUM FORMATE, PH 7.0, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 277K	Resolution 2.45 Å R-free 0.267
5XFL Crystal structure of the force-sensing device region of alpha N-catenin Deposited 2017-04-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 260–632（373 aa） Fragment：UNP residues 260-632	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；277 K；100MM HEPES, 20% PEG3350, 200MM POTASSIUM FORMATE, PH 7.0, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 277K	Resolution 2.45 Å R-free 0.267
5XFL Crystal structure of the force-sensing device region of alpha N-catenin Deposited 2017-04-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 260–632（373 aa） Fragment：UNP residues 260-632	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；277 K；100MM HEPES, 20% PEG3350, 200MM POTASSIUM FORMATE, PH 7.0, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 277K	Resolution 2.45 Å R-free 0.267
6DUY Crystal structure of the alpha-N-catenin actin-binding domain H1 mutant Deposited 2018-06-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 664–918（255 aa） Chain B 664–918（255 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；100 mM sodium acetate/acetic acid, pH 4.5, 0.8 M sodium phosphate monobasic, 1.2 M potassium phosphate dibasic	Resolution 2.81 Å R-free 0.255

4 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CTNA2_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–248； UniProt 18–264 Author chain C； PDBConstruct 2–248； UniProt 18–264

Catenin beta-1

Mus musculus

UniProt Q02248

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 78–151	Fragment：alpha-catenin binding domain, UNP residues 78-151	Catenin alpha-2 × 1 （Q61301）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.2；283 K；100mM Tris-Cl, 22% polyethylene glycol monomethryl ether, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 283K	Resolution 2.80 Å R-free 0.264
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 78–151	Fragment：alpha-catenin binding domain, UNP residues 78-151	Catenin alpha-2 × 1 （Q61301）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.2；283 K；100mM Tris-Cl, 22% polyethylene glycol monomethryl ether, pH 8.2, VAPOR DIFFUSION, HANGING DROP, temperature 283K	Resolution 2.80 Å R-free 0.264

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4ONS	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DOW CRYSTAL STRUCTURE OF A CHIMERA OF BETA-CATENIN AND ALPHA-CATENIN Deposited 1999-12-21	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 118–149（32 aa） Fragment：ALPHA-CATENIN BINDING REGION	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；PEG 2000 monomethylether, HEPES, urea, ethanol, Dithiothreitol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 295.0K	Resolution 1.80 Å R-free 0.233
1I7W BETA-CATENIN/PHOSPHORYLATED E-CADHERIN COMPLEX Deposited 2001-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 134–671（538 aa） Fragment：ARMADILLO DOMAIN Chain C 134–671（538 aa） Fragment：ARMADILLO DOMAIN	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；polyethylene glycol monomethylether 5000, Tris-HCl, NaCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.245
1I7X BETA-CATENIN/E-CADHERIN COMPLEX Deposited 2001-03-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 134–671（538 aa） Fragment：ARMADILLO DOMAIN Chain C 134–671（538 aa） Fragment：ARMADILLO DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；POLYETHYLENEIMINE TRIS-HCL ISOPROPANOL, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.242
1JPP The Structure of a beta-Catenin Binding Repeat from Adenomatous Polyposis Coli (APC) in Complex with beta-Catenin Deposited 2001-08-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 134–671（538 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；PEG 8000, sodium potassium phosphate, sodium chloride, DTT, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.274
1JPP The Structure of a beta-Catenin Binding Repeat from Adenomatous Polyposis Coli (APC) in Complex with beta-Catenin Deposited 2001-08-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 134–671（538 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；PEG 8000, sodium potassium phosphate, sodium chloride, DTT, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.274
1M1E Beta-catenin armadillo repeat domain bound to ICAT Deposited 2002-06-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 134–671（538 aa） Fragment：Armadillo Repeat Region (RESIDUES 134-671)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；MES, MPD, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.228
1V18 The crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated APC 20mer repeat. Deposited 2004-04-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 134–671（538 aa） Fragment：ARMADILLO REPEAT, REPEAT 3 OF APC, RESIDUES 134-671	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 2.10 Å R-free 0.253
2BCT THE ARMADILLO REPEAT REGION FROM MURINE BETA-CATENIN Deposited 1997-07-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 150–665（516 aa） Fragment：ARMADILLO REPEAT REGION	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；10% (W/V) PEG 8000, 875 MM NACL, 200 MM TRIS-HCL, PH 8.5	Resolution 2.90 Å R-free 0.288
3BCT THE ARMADILLO REPEAT REGION FROM MURINE BETA-CATENIN Deposited 1997-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 193–662（470 aa） Fragment：ARMADILLO REPEAT REGION	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1 URE UREA × 8	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.5% (W/V) PEG 8000, 2.4 M UREA, 200 MM TRIS-HCL, PH 8.5	Resolution 2.10 Å R-free 0.260
3BCT THE ARMADILLO REPEAT REGION FROM MURINE BETA-CATENIN Deposited 1997-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 193–662（470 aa） Fragment：ARMADILLO REPEAT REGION	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2 URE UREA × 16	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.5% (W/V) PEG 8000, 2.4 M UREA, 200 MM TRIS-HCL, PH 8.5	Resolution 2.10 Å R-free 0.260
3OUW Structure of beta-catenin with Lef-1 Deposited 2010-09-15	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 134–671（538 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；296 K；well solution: 4.2% PEG 4000, 100 mM sodium citrate. protein solution: 100 uM beta-cat-arm, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.91 Å R-free 0.256
3OUX Structure of beta-catenin with phosphorylated Lef-1 Deposited 2010-09-15	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 134–671（538 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；296 K；well solution: 7% PEG 3000, 100 mM sodium citrate. protein solution: 100 micro-M beta-cat-arm, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.40 Å R-free 0.264
4EV8 Crystal structure of mouse catenin beta-59 in 2.4M urea. Deposited 2012-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 134–671（538 aa）	Not recorded	URE UREA × 18	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å R-free 0.220
4EV9 Crystal Structure of Mouse Catenin beta-59 in 4.0M urea Deposited 2012-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 134–671（538 aa） Fragment：unp residues 134-671	Not recorded	URE UREA × 42	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；1.6~3.2 M Urea, 200mM Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.10 Å R-free 0.232
4EVA Crystal Structure of Mouse Catenin beta-59 in 5.6M urea Deposited 2012-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 134–671（538 aa） Fragment：unp residues 134-671	Not recorded	URE UREA × 38	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；1.6~3.2 M Urea, 200mM Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.228
4EVA Crystal Structure of Mouse Catenin beta-59 in 5.6M urea Deposited 2012-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 134–671（538 aa） Fragment：unp residues 134-671	Not recorded	URE UREA × 34	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；1.6~3.2 M Urea, 200mM Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.228
4EVP Crystal Structure of Mouse Catenin beta-59 in 7.2M urea Deposited 2012-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 134–671（538 aa） Fragment：unp residues 134-671	Not recorded	URE UREA × 43	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；VAPOR DIFFUSION, HANGING DROP	Resolution 2.25 Å R-free 0.225
4EVT Crystal Structure of Mouse Catenin beta-59 in 8.3M urea Deposited 2012-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 134–671（538 aa） Fragment：unp residues 134-671	Not recorded	URE UREA × 56	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；1.6~3.2 M Urea, 200mM Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.34 Å R-free 0.225

15 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CTNB1_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 15–88； UniProt 78–151 Author chain D； PDBConstruct 15–88； UniProt 78–151

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ons
Deposition date deposition_date	2014-01-29
Structure title title	Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin complex formation
Keywords keywords	four helix bundles, cell adhesion; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.75 Å
Radius of gyration Rg (electron density) rg_electron	28.04 Å
Forward intensity I(0) i0	64337600.00
Molecular weight molecular_weight	61323.0 kDa
Excluded volume excluded_volume	76468 Å³
Envelope volume envelope_volume	99395 Å³
Hydration-shell volume shell_volume	30713 Å³
Envelope diameter envelope_diameter	100.2 Å
Shell Rg shell_rg	34.07 Å
Envelope Rg envelope_rg	27.91 Å
Shape Rg shape_rg	28.03 Å
Total Rg total_rg	28.67 Å
Total atoms total_atoms	4296
Residues n_residues	552
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	94.1 Å
Rg (real space) rg_real	28.78 Å
Rg uncertainty (real space) rg_real_error	0.71 Å
I(0) (real space) i0_real	6.4340e+07
I(0) uncertainty (real space) i0_real_error	9.0190e+05
Rg (reciprocal space) rg_reciprocal	28.77 Å
I(0) (reciprocal space) i0_reciprocal	64340000.0000
Solution quality estimate total_estimate	0.8878
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	35.9 Å
Skewness Skewness skewness	0.393
Kurtosis Kurtosis kurtosis	-0.233
Angular range angular_range	— – 0.2750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	12340000.0000
Real-space data points n_real_points	56
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.881; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.970; Smooth: 0.925

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Catenin alpha-2
Molecular weight formula_weight	27351.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	4318

MEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISSAAQATSPT

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Catenin beta-1
Molecular weight formula_weight	9913.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MGSSHHHHHHSQDPQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATR

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	22

▼

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	4onsA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	230 — Alpha-catenin/vinculin-like

Domain ID domain_id	4onsA02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	230 — Alpha-catenin/vinculin-like

Domain ID domain_id	4onsB00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2780 —

Domain ID domain_id	4onsC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	230 — Alpha-catenin/vinculin-like

Domain ID domain_id	4onsC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	230 — Alpha-catenin/vinculin-like

Domain ID domain_id	4onsD00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2780 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	96.125 Å
Unit-cell length b length_b	96.125 Å
Unit-cell length c length_c	65.517 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 31
Space-group number int_tables_number	144
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	38.753 Å
R factor r_factor	0.2075
R_work r_work	0.2033
R_free r_free	0.2637

fit	/app/data/saxs_computation/on/4ons/4ons.fit
pddf	/app/data/pr_computation/on/4ons/4ons.pr.out
profile	/app/data/saxs_computation/on/4ons/4ons.dat

Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin complex formation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Catenin alpha-2

State in the Current Structure

Other States of the Same Protein in the Database

Catenin beta-1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)