SAXSdb — 5hx2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate wedge protein gp7

Enterobacteria phage T4

UniProt P19061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp53 × 6 （P16011） Baseplate wedge protein gp10 × 18 （P10928）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp53 × 1 （P16011） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp53 × 1 （P16011） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP07_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1032； UniProt 1–1032

Baseplate wedge protein gp8

Enterobacteria phage T4

UniProt P19062

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp53 × 6 （P16011） Baseplate wedge protein gp10 × 18 （P10928）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp53 × 1 （P16011） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp53 × 1 （P16011） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP08_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–334； UniProt 1–334 Author chain C； PDBConstruct 1–334； UniProt 1–334

Baseplate wedge protein gp6

Enterobacteria phage T4

UniProt P19060

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp53 × 6 （P16011） Baseplate wedge protein gp10 × 18 （P10928）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp53 × 1 （P16011） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp53 × 1 （P16011） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP06_BPT4
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–660； UniProt 1–660 Author chain E； PDBConstruct 1–660； UniProt 1–660

Baseplate wedge protein gp53

Enterobacteria phage T4

UniProt P16011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp10 × 18 （P10928）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp10 × 3 （P10928）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP53_BPT4
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–196； UniProt 1–196

Baseplate wedge protein gp10

Enterobacteria phage T4

UniProt P10928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 54	Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp53 × 6 （P16011）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp53 × 1 （P16011）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 9	Baseplate wedge protein gp7 × 1 （P19061） Baseplate wedge protein gp8 × 2 （P19062） Baseplate wedge protein gp6 × 2 （P19060） Baseplate wedge protein gp53 × 1 （P16011）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP10_BPT4
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–602； UniProt 1–602 Author chain H； PDBConstruct 1–602； UniProt 1–602 Author chain I； PDBConstruct 1–602； UniProt 1–602

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5hx2
Deposition date deposition_date	2016-01-29
Structure title title	In vitro assembled star-shaped hubless T4 baseplate
Keywords keywords	T4, baseplate, complex, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5hx2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5hx2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5hx2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	137.10 Å
Total Rg	136.00 Å
Atom count	171672
Residues	25134
Excluded volume	2980900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5hx2__assembly_1__model_1`	54-meric （54）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5hx2__assembly_2__model_1`	nonameric （9）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`5hx2__assembly_3__model_1`	nonameric （9）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Baseplate wedge protein gp7
Molecular weight formula_weight	119336.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	28612

MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLGYTANNSFFFDDADPLTTYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLANKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGSIQQVCKDINRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVYYQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYATLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNALIDFDPLSPTYSERLFEPDTMTITGNPKAVCYKMDSICDKVFALIIGEVETLNANPRTSKIIDSADKGIYVLNHDEKTWKRVFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQLIGAVKYEFPREWLADKHYHMMAFIADETSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAVVVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKASGEIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTMMPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRNIYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIVQSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLPSFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIAITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRIAKLTPTGEIEHDSVTGEAIYEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRLKDNIGNPRDPENPTQVKIDE

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Baseplate wedge protein gp8
Molecular weight formula_weight	38041.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPYPTDSVLGVTDMWTHMMGTVKVLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYNATESGAGWLVYRCLDVPDTGMCSIASLTDKDECLKLGGKWTPSARSMTPPEGRGDAEGTIEPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIYRVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKAHPNDPNVKAEKDYYDPEDLMRHSGEMIYMENRPPIIMAMDQTEEINILFTF

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Baseplate wedge protein gp6
Molecular weight formula_weight	74492.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

MANTPVNYQLTRTANAIPEIFVGGTFAEIKQNLIEWLNGQNEFLDYDFEGSRLNVLCDLLAYNTLYIQQFGNAAVYESFMRTANLRSSVVQAAQDNGYLPTSKSAAQTEIMLTCTDALNRNYITIPRGTRFLAYAKDTSVNPYNFVSREDVIAIRDKNNQYFPRLKLAQGRIVRTEIIYDKLTPIIIYDKNIDRNQVKLYVDGAEWINWTRKSMVHAGSTSTIYYMRETIDGNTEFYFGEGEISVNASEGALTANYIGGLKPTQNSTIVIEYISTNGADANGAVGFSYADTLTNITVININENPNDDPDFVGADGGGDPEDIERIRELGTIKRETQQRCVTATDYDTFVSERFGSIIQAVQTFTDSTKPGYAFIAAKPKSGLYLTTVQREDIKNYLKDYNLAPITPSIISPNYLFIKTNLKVTYALNKLQESEQWLEGQIIDKIDRYYTEDVEIFNSSFAKSKMLTYVDDADHSVIGSSATIQMVREVQNFYKTPEAGIKYNNQIKDRSMESNTFSFNSGRKVVNPDTGLEEDVLYDVRIVSTDRDSKGIGKVIIGPFASGDVTENENIQPYTGNDFNKLANSDGRDKYYVIGEINYPADVIYWNIAKINLTSEKFEVQTIELYSDPTDDVIFTRDGSLIVFENDLRPQYLTIDLEPISQ

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Baseplate wedge protein gp53
Molecular weight formula_weight	22990.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	Baseplate wedge protein gp10
Molecular weight formula_weight	66281.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I

MKQNINIGNVVDDGTGDYLRKGGIKINENFDELYYELGDGDVPYSAGAWKTYNASSGQTLTAEWGKSYAINTSSGRVTINLPKGTVNDYNKVIRARDVFATWNVNPVTLVAASGDTIKGSAVPVEINVRFSDLELVYCAPGRWEYVKNKQIDKITSSDISNVARKEFLVEVQGQTDFLDVFRGTSYNVNNIRVKHRGNELYYGDVFSENSDFGSPGENEGELVPLDGFNIRLRQPCNIGDTVQIETFMDGVSQWRSSYTRRQIRLLDSKLTSKTSLEGSIYVTDLSTMKSIPFSAFGLIPGEPINPNSLEVRFNGILQELAGTVGMPLFHCVGADSDDEVECSVLGGTWEQSHTDYSVETDENGIPEILHFDSVFEHGDIINITWFNNDLGTLLTKDEIIDETDNLYVSQGPGVDISGDVNLTDFDKIGWPNVEAVQSYQRAFNAVSNIFDTIYPIGTIYENAVNPNNPVTYMGFGSWKLFGQGKVLVGWNEDISDPNFALNNNDLDSGGNPSHTAGGTGGSTSVTLENANLPATETDEEVLIVDENGSVIVGGCQYDPDESGPIYTKYREAKASTNSTHTPPTSITNIQPYITVYRWIRIA

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	5hx2B01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	340 — baseplate structural protein gp8, domain 1
Homologous superfamily homologous superfamily	10 — baseplate structural protein gp8, domain 1

Domain ID domain_id	5hx2B02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	290 — baseplate structural protein gp8, domain 2
Homologous superfamily homologous superfamily	10 — baseplate structural protein gp8, domain 2

Domain ID domain_id	5hx2C01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	340 — baseplate structural protein gp8, domain 1
Homologous superfamily homologous superfamily	10 — baseplate structural protein gp8, domain 1

Domain ID domain_id	5hx2C02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	290 — baseplate structural protein gp8, domain 2
Homologous superfamily homologous superfamily	10 — baseplate structural protein gp8, domain 2

Domain ID domain_id	5hx2D01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	200 —

Domain ID domain_id	5hx2E03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	300 — GMP Synthetase; Chain A, domain 3
Homologous superfamily homologous superfamily	200 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	45607

In vitro assembled star-shaped hubless T4 baseplate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate wedge protein gp7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp53

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5hx2__assembly_1__model_1

5hx2__assembly_1__model_1 | I(q)

5hx2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)