5iv5

Cryo-electron microscopy structure of the hexagonal pre-attachment T4 baseplate-tail tube complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate wedge protein gp6

OrganismNot specified

UniProt P19060

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP06_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–660； UniProt 1–660 Author chain B； PDBConstruct 1–660； UniProt 1–660 Author chain BH； PDBConstruct 1–660； UniProt 1–660 Author chain BI； PDBConstruct 1–660； UniProt 1–660 Author chain EA； PDBConstruct 1–660； UniProt 1–660 Author chain EB； PDBConstruct 1–660； UniProt 1–660 Author chain GD； PDBConstruct 1–660； UniProt 1–660 Author chain GE； PDBConstruct 1–660； UniProt 1–660 Author chain X； PDBConstruct 1–660； UniProt 1–660 Author chain Y； PDBConstruct 1–660； UniProt 1–660 Author chain u； PDBConstruct 1–660； UniProt 1–660 Author chain v； PDBConstruct 1–660； UniProt 1–660

Baseplate wedge protein gp7

OrganismNot specified

UniProt P19061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP07_BPT4
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–1032； UniProt 1–1032 Author chain C； PDBConstruct 1–1032； UniProt 1–1032 Author chain EC； PDBConstruct 1–1032； UniProt 1–1032 Author chain GF； PDBConstruct 1–1032； UniProt 1–1032 Author chain Z； PDBConstruct 1–1032； UniProt 1–1032 Author chain w； PDBConstruct 1–1032； UniProt 1–1032

Baseplate wedge protein gp8

OrganismNot specified

UniProt P19062

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP08_BPT4
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain CA； PDBConstruct 1–334； UniProt 1–334 Author chain CB； PDBConstruct 1–334； UniProt 1–334 Author chain D； PDBConstruct 1–334； UniProt 1–334 Author chain E； PDBConstruct 1–334； UniProt 1–334 Author chain ED； PDBConstruct 1–334； UniProt 1–334 Author chain EE； PDBConstruct 1–334； UniProt 1–334 Author chain GG； PDBConstruct 1–334； UniProt 1–334 Author chain GH； PDBConstruct 1–334； UniProt 1–334 Author chain a； PDBConstruct 1–334； UniProt 1–334 Author chain b； PDBConstruct 1–334； UniProt 1–334 Author chain x； PDBConstruct 1–334； UniProt 1–334 Author chain y； PDBConstruct 1–334； UniProt 1–334

Baseplate wedge protein gp9

OrganismNot specified

UniProt P10927

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP09_BPT4
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AA； PDBConstruct 1–288； UniProt 1–288 Author chain AB； PDBConstruct 1–288； UniProt 1–288 Author chain CC； PDBConstruct 1–288； UniProt 1–288 Author chain CD； PDBConstruct 1–288； UniProt 1–288 Author chain CE； PDBConstruct 1–288； UniProt 1–288 Author chain EF； PDBConstruct 1–288； UniProt 1–288 Author chain EG； PDBConstruct 1–288； UniProt 1–288 Author chain EH； PDBConstruct 1–288； UniProt 1–288 Author chain F； PDBConstruct 1–288； UniProt 1–288 Author chain G； PDBConstruct 1–288； UniProt 1–288 Author chain GI； PDBConstruct 1–288； UniProt 1–288 Author chain GJ； PDBConstruct 1–288； UniProt 1–288 Author chain H； PDBConstruct 1–288； UniProt 1–288 Author chain HA； PDBConstruct 1–288； UniProt 1–288 Author chain c； PDBConstruct 1–288； UniProt 1–288 Author chain d； PDBConstruct 1–288； UniProt 1–288 Author chain e； PDBConstruct 1–288； UniProt 1–288 Author chain z； PDBConstruct 1–288； UniProt 1–288

Baseplate wedge protein gp10

OrganismNot specified

UniProt P10928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP10_BPT4
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AC； PDBConstruct 1–602； UniProt 1–602 Author chain AD； PDBConstruct 1–602； UniProt 1–602 Author chain AE； PDBConstruct 1–602； UniProt 1–602 Author chain CF； PDBConstruct 1–602； UniProt 1–602 Author chain CG； PDBConstruct 1–602； UniProt 1–602 Author chain CH； PDBConstruct 1–602； UniProt 1–602 Author chain EI； PDBConstruct 1–602； UniProt 1–602 Author chain EJ； PDBConstruct 1–602； UniProt 1–602 Author chain FA； PDBConstruct 1–602； UniProt 1–602 Author chain HB； PDBConstruct 1–602； UniProt 1–602 Author chain HC； PDBConstruct 1–602； UniProt 1–602 Author chain HD； PDBConstruct 1–602； UniProt 1–602 Author chain I； PDBConstruct 1–602； UniProt 1–602 Author chain J； PDBConstruct 1–602； UniProt 1–602 Author chain K； PDBConstruct 1–602； UniProt 1–602 Author chain f； PDBConstruct 1–602； UniProt 1–602 Author chain g； PDBConstruct 1–602； UniProt 1–602 Author chain h； PDBConstruct 1–602； UniProt 1–602

Baseplate wedge protein gp11

OrganismNot specified

UniProt P10929

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP11_BPT4
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AF； PDBConstruct 1–219； UniProt 1–219 Author chain AG； PDBConstruct 1–219； UniProt 1–219 Author chain AH； PDBConstruct 1–219； UniProt 1–219 Author chain CI； PDBConstruct 1–219； UniProt 1–219 Author chain CJ； PDBConstruct 1–219； UniProt 1–219 Author chain DA； PDBConstruct 1–219； UniProt 1–219 Author chain FB； PDBConstruct 1–219； UniProt 1–219 Author chain FC； PDBConstruct 1–219； UniProt 1–219 Author chain FD； PDBConstruct 1–219； UniProt 1–219 Author chain HE； PDBConstruct 1–219； UniProt 1–219 Author chain HF； PDBConstruct 1–219； UniProt 1–219 Author chain HG； PDBConstruct 1–219； UniProt 1–219 Author chain L； PDBConstruct 1–219； UniProt 1–219 Author chain M； PDBConstruct 1–219； UniProt 1–219 Author chain N； PDBConstruct 1–219； UniProt 1–219 Author chain i； PDBConstruct 1–219； UniProt 1–219 Author chain j； PDBConstruct 1–219； UniProt 1–219 Author chain k； PDBConstruct 1–219； UniProt 1–219

Short tail fiber protein gp12

OrganismNot specified

UniProt P10930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FIB12_BPT4
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AI； PDBConstruct 1–527； UniProt 1–527 Author chain AJ； PDBConstruct 1–527； UniProt 1–527 Author chain BA； PDBConstruct 1–527； UniProt 1–527 Author chain DB； PDBConstruct 1–527； UniProt 1–527 Author chain DC； PDBConstruct 1–527； UniProt 1–527 Author chain DD； PDBConstruct 1–527； UniProt 1–527 Author chain FE； PDBConstruct 1–527； UniProt 1–527 Author chain FF； PDBConstruct 1–527； UniProt 1–527 Author chain FG； PDBConstruct 1–527； UniProt 1–527 Author chain HH； PDBConstruct 1–527； UniProt 1–527 Author chain HI； PDBConstruct 1–527； UniProt 1–527 Author chain HJ； PDBConstruct 1–527； UniProt 1–527 Author chain O； PDBConstruct 1–527； UniProt 1–527 Author chain P； PDBConstruct 1–527； UniProt 1–527 Author chain Q； PDBConstruct 1–527； UniProt 1–527 Author chain l； PDBConstruct 1–527； UniProt 1–527 Author chain m； PDBConstruct 1–527； UniProt 1–527 Author chain n； PDBConstruct 1–527； UniProt 1–527

Tail tube protein gp19

OrganismNot specified

UniProt P13333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TUBE_BPT4
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BB； PDBConstruct 1–163； UniProt 1–163 Author chain BC； PDBConstruct 1–163； UniProt 1–163 Author chain DE； PDBConstruct 1–163； UniProt 1–163 Author chain DF； PDBConstruct 1–163； UniProt 1–163 Author chain FH； PDBConstruct 1–163； UniProt 1–163 Author chain FI； PDBConstruct 1–163； UniProt 1–163 Author chain IA； PDBConstruct 1–163； UniProt 1–163 Author chain IB； PDBConstruct 1–163； UniProt 1–163 Author chain R； PDBConstruct 1–163； UniProt 1–163 Author chain S； PDBConstruct 1–163； UniProt 1–163 Author chain o； PDBConstruct 1–163； UniProt 1–163 Author chain p； PDBConstruct 1–163； UniProt 1–163

Baseplate wedge protein gp25

OrganismNot specified

UniProt P09425

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP25_BPT4
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain BD； PDBConstruct 1–132； UniProt 1–132 Author chain DG； PDBConstruct 1–132； UniProt 1–132 Author chain FJ； PDBConstruct 1–132； UniProt 1–132 Author chain IC； PDBConstruct 1–132； UniProt 1–132 Author chain T； PDBConstruct 1–132； UniProt 1–132 Author chain q； PDBConstruct 1–132； UniProt 1–132

Baseplate tail-tube protein gp48

OrganismNot specified

UniProt P13339

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP48_BPT4
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain BE； PDBConstruct 1–364； UniProt 1–364 Author chain DH； PDBConstruct 1–364； UniProt 1–364 Author chain GA； PDBConstruct 1–364； UniProt 1–364 Author chain ID； PDBConstruct 1–364； UniProt 1–364 Author chain U； PDBConstruct 1–364； UniProt 1–364 Author chain r； PDBConstruct 1–364； UniProt 1–364

Baseplate wedge protein gp53

OrganismNot specified

UniProt P16011

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP53_BPT4
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain BF； PDBConstruct 1–196； UniProt 1–196 Author chain DI； PDBConstruct 1–196； UniProt 1–196 Author chain GB； PDBConstruct 1–196； UniProt 1–196 Author chain IE； PDBConstruct 1–196； UniProt 1–196 Author chain V； PDBConstruct 1–196； UniProt 1–196 Author chain s； PDBConstruct 1–196； UniProt 1–196

Baseplate tail-tube protein gp54

OrganismNot specified

UniProt P13341

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP54_BPT4
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain BG； PDBConstruct 1–320； UniProt 1–320 Author chain DJ； PDBConstruct 1–320； UniProt 1–320 Author chain GC； PDBConstruct 1–320； UniProt 1–320 Author chain IF； PDBConstruct 1–320； UniProt 1–320 Author chain W； PDBConstruct 1–320； UniProt 1–320 Author chain t； PDBConstruct 1–320； UniProt 1–320

Peptidoglycan hydrolase gp5

OrganismNot specified

UniProt P16009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Baseplate hub protein gp27 × 3 （P17172） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NEEDL_BPT4
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain YA； PDBConstruct 1–575； UniProt 1–575 Author chain YB； PDBConstruct 1–575； UniProt 1–575 Author chain YC； PDBConstruct 1–575； UniProt 1–575

Baseplate hub protein gp27

OrganismNot specified

UniProt P17172

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region × 1 （P39234） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP27_BPT4
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain YD； PDBConstruct 1–391； UniProt 1–391 Author chain YE； PDBConstruct 1–391； UniProt 1–391 Author chain YF； PDBConstruct 1–391； UniProt 1–391

Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region

OrganismNot specified

UniProt P39234

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	Baseplate wedge protein gp6 × 12 （P19060） Baseplate wedge protein gp7 × 6 （P19061） Baseplate wedge protein gp8 × 12 （P19062） Baseplate wedge protein gp9 × 18 （P10927） Baseplate wedge protein gp10 × 18 （P10928） Baseplate wedge protein gp11 × 18 （P10929） Short tail fiber protein gp12 × 18 （P10930） Tail tube protein gp19 × 12 （P13333） Baseplate wedge protein gp25 × 6 （P09425） Baseplate tail-tube protein gp48 × 6 （P13339） Baseplate wedge protein gp53 × 6 （P16011） Baseplate tail-tube protein gp54 × 6 （P13341） Peptidoglycan hydrolase gp5 × 3 （P16009） Baseplate hub protein gp27 × 3 （P17172） ZINC ION × 6 FE (III) ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y08B_BPT4
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain ZA； PDBConstruct 1–97； UniProt 1–97

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5iv5
Deposition date deposition_date	2016-03-19
Structure title title	Cryo-electron microscopy structure of the hexagonal pre-attachment T4 baseplate-tail tube complex
Keywords keywords	;T4, baseplate-tail tube complex, pre-attachment, bacteriophage, bacterial virus, hexagonal, membrane-piercing, cell attachment, infection, Viral protein ;; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5iv5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5iv5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5iv5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	166.00 Å
Total Rg	166.10 Å
Atom count	438116
Residues	56082
Excluded volume	7733700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5iv5__assembly_1__model_1`	145-meric （145）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Baseplate wedge protein gp6
Molecular weight formula_weight	74492.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,X,Y,u,v,BH,BI,EA,EB,GD,GE
Atom count atom_count	549576

MANTPVNYQLTRTANAIPEIFVGGTFAEIKQNLIEWLNGQNEFLDYDFEGSRLNVLCDLLAYNTLYIQQFGNAAVYESFMRTANLRSSVVQAAQDNGYLPTSKSAAQTEIMLTCTDALNRNYITIPRGTRFLAYAKDTSVNPYNFVSREDVIAIRDKNNQYFPRLKLAQGRIVRTEIIYDKLTPIIIYDKNIDRNQVKLYVDGAEWINWTRKSMVHAGSTSTIYYMRETIDGNTEFYFGEGEISVNASEGALTANYIGGLKPTQNSTIVIEYISTNGADANGAVGFSYADTLTNITVININENPNDDPDFVGADGGGDPEDIERIRELGTIKRETQQRCVTATDYDTFVSERFGSIIQAVQTFTDSTKPGYAFIAAKPKSGLYLTTVQREDIKNYLKDYNLAPITPSIISPNYLFIKTNLKVTYALNKLQESEQWLEGQIIDKIDRYYTEDVEIFNSSFAKSKMLTYVDDADHSVIGSSATIQMVREVQNFYKTPEAGIKYNNQIKDRSMESNTFSFNSGRKVVNPDTGLEEDVLYDVRIVSTDRDSKGIGKVIIGPFASGDVTENENIQPYTGNDFNKLANSDGRDKYYVIGEINYPADVIYWNIAKINLTSEKFEVQTIELYSDPTDDVIFTRDGSLIVFENDLRPQYLTIDLEPISQ

Entity 2 Entity 2 polymer

Description description	Baseplate wedge protein gp7
Molecular weight formula_weight	119336.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Z,w,BJ,EC,GF

MTVKAPSVTSLRISKLSANQVQVRWDDVGANFYYFVEIAETKTNSGENLPSNQYRWINLGYTANNSFFFDDADPLTTYIIRVATAAQDFEQSDWIYTEEFETFATNAYTFQNMIEMQLANKFIQEKFTLNNSDYVNFNNDTIMAALMNESFQFSPSYVDVSSISNFIIGENEYHEIQGSIQQVCKDINRVYLMESEGILYLFERYQPVVKVSNDKGQTWKAVKLFNDRVGYPLSKTVYYQSANTTYVLGYDKIFYGRKSTDVRWSADDVRFSSQDITFAKLGDQLHLGFDVEIFATYATLPANVYRIAEAITCTDDYIYVVARDKVRYIKTSNALIDFDPLSPTYSERLFEPDTMTITGNPKAVCYKMDSICDKVFALIIGEVETLNANPRTSKIIDSADKGIYVLNHDEKTWKRVFGNTEEERRRIQPGYANMSTDGKLVSLSSSNFKFLSDNVVNDPETAAKYQLIGAVKYEFPREWLADKHYHMMAFIADETSDWETFTPQPMKYYAEPFFNWSKKSNTRCWINNSDRAVVVYADLKYTKVIENIPETSPDRLVHEYWDDGDCTIVMPNVKFTGFKKYASGMLFYKASGEIISYYDFNYRVRDTVEIIWKPTEVFLKAFLQNQEHETPWSPEEERGLADPDLRPLIGTMMPDSYLLQDSNFEAFCEAYIQYLSDGYGTQYNNLRNLIRNQYPREEHAWEYLWSEIYKRNIYLNADKRDAVARFFESRSYDFYSTKGIEASYKFLFKVLYNEEVEIEIESGAGTEYDIIVQSDSLTEDLVGQTIYTATGRCNVTYIERSYSNGKLQWTVTIHNLLGRLIAGQEVKAERLPSFEGEIIRGVKGKDLLQNNIDYINRSRSYYVMKIKSNLPSSRWKSDVIRFVHPVGFGFIAITLLTMFINVGLTLKHTETIINKYKNYKWDSGLPTEYADRIAKLTPTGEIEHDSVTGEAIYEPGPMAGVKYPLPDDYNAENNNSIFQGQLPSERRKLMSPLFDASGTTFAQFRDLVNKRLKDNIGNPRDPENPTQVKIDE

Entity 3 Entity 3 polymer

Description description	Baseplate wedge protein gp8
Molecular weight formula_weight	38041.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,a,b,x,y,CA,CB,ED,EE,GG,GH

MNDSSVIYRAIVTSKFRTEKMLNFYNSIGSGPDKNTIFITFGRSEPWSSNENEVGFAPPYPTDSVLGVTDMWTHMMGTVKVLPSMLDAVIPRRDWGDTRYPDPYTFRINDIVVCNSAPYNATESGAGWLVYRCLDVPDTGMCSIASLTDKDECLKLGGKWTPSARSMTPPEGRGDAEGTIEPGDGYVWEYLFEIPPDVSINRCTNEYIVVPWPEELKEDPTRWGYEDNLTWQQDDFGLIYRVKANTIRFKAYLDSVYFPEAALPGNKGFRQISIITNPLEAKAHPNDPNVKAEKDYYDPEDLMRHSGEMIYMENRPPIIMAMDQTEEINILFTF

Entity 4 Entity 4 polymer

Description description	Baseplate wedge protein gp9
Molecular weight formula_weight	31024.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,c,d,e,z,AA,AB,CC,CD,CE,EF,EG,EH,GI,GJ,HA

MFIQEPKKLIDTGEIGNASTGDILFDGGNKINSDFNAIYNAFGDQRKMAVANGTGADGQIIHATGYYQKHSITEYATPVKVGTRHDIDTSTVGVKVIIERGELGDCVEFINSNGSISVTNPLTIQAIDSIKGVSGNLVVTSPYSKVTLRCISSDNSTSVWNYSIESMFGQKESPAEGTWNISTSGSVDIPLFHRTEYNMAKLLVTCQSVDGRKIKTAEINILVDTVNSEVISSEYAVMRVGNETEEDEIANIAFSIKENYVTATISSSTVGMRAAVKVIATQKIGVAQ

Entity 5 Entity 5 polymer

Description description	Baseplate wedge protein gp10
Molecular weight formula_weight	66281.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,f,g,h,AC,AD,AE,CF,CG,CH,EI,EJ,FA,HB,HC,HD

MKQNINIGNVVDDGTGDYLRKGGIKINENFDELYYELGDGDVPYSAGAWKTYNASSGQTLTAEWGKSYAINTSSGRVTINLPKGTVNDYNKVIRARDVFATWNVNPVTLVAASGDTIKGSAVPVEINVRFSDLELVYCAPGRWEYVKNKQIDKITSSDISNVARKEFLVEVQGQTDFLDVFRGTSYNVNNIRVKHRGNELYYGDVFSENSDFGSPGENEGELVPLDGFNIRLRQPCNIGDTVQIETFMDGVSQWRSSYTRRQIRLLDSKLTSKTSLEGSIYVTDLSTMKSIPFSAFGLIPGEPINPNSLEVRFNGILQELAGTVGMPLFHCVGADSDDEVECSVLGGTWEQSHTDYSVETDENGIPEILHFDSVFEHGDIINITWFNNDLGTLLTKDEIIDETDNLYVSQGPGVDISGDVNLTDFDKIGWPNVEAVQSYQRAFNAVSNIFDTIYPIGTIYENAVNPNNPVTYMGFGSWKLFGQGKVLVGWNEDISDPNFALNNNDLDSGGNPSHTAGGTGGSTSVTLENANLPATETDEEVLIVDENGSVIVGGCQYDPDESGPIYTKYREAKASTNSTHTPPTSITNIQPYITVYRWIRIA

Entity 6 Entity 6 polymer

Description description	Baseplate wedge protein gp11
Molecular weight formula_weight	23725.5 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,N,i,j,k,AF,AG,AH,CI,CJ,DA,FB,FC,FD,HE,HF,HG

MSLLNNKAGVISRLADFLGFRPKTGDIDVMNRQSVGSVTISQLAKGFYEPNIESAINDVHNFSIKDVGTIITNKTGVSPEGVSQTDYWAFSGTVTDDSLPPGSPITVLVFGLPVSATTGMTAIEFVAKVRVALQEAIASFTAINSYKDHPTDGSKLEVTYLDNQKHVLSTYSTYGITISQEIISESKPGYGTWNLLGAQTVTLDNQQTPTVFYHFERTA

Entity 7 Entity 7 polymer

Description description	Short tail fiber protein gp12
Molecular weight formula_weight	56253.9 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,l,m,n,AI,AJ,BA,DB,DC,DD,FE,FF,FG,HH,HI,HJ

MSNNTYQHVSNESRYVKFDPTDTNFPPEITDVQAAIAAISPAGVNGVPDASSTTKGILFIPTEQEVIDGTNNTKAVTPATLATRLSYPNATETVYGLTRYSTNDEAIAGVNNESSITPAKFTVALNNAFETRVSTESSNGVIKISSLPQALAGADDTTAMTPLKTQQLAIKLIAQIAPSETTATESDQGVVQLATVAQVRQGTLREGYAISPYTFMNSSSTEEYKGVIKLGTQSEVNSNNASVAVTGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVRMTGGYIQGNRIVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGNPSNPGLPDMRGLFVRGSGRGSHLTNPNVNGNDQFGKPRLGVGCTGGYVGEVQIQQMSYHKHAGGFGEHDDLGAFGNTRRSNFVGTRKGLDWDNRSYFTNDGYEIDPESQRNSKYTLNRPELIGNETRPWNISLNYIIKVKE

Entity 8 Entity 8 polymer

Description description	Tail tube protein gp19
Molecular weight formula_weight	18479.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S,o,p,BB,BC,DE,DF,FH,FI,IA,IB

MFVDDVTRAFESGDFARPNLFQVEISYLGQNFTFQCKATALPAGIVEKIPVGFMNRKINVAGDRTFDDWTVTVMNDEAHDARQKFVDWQSIAAGQGNEITGGKPAEYKKSAIVRQYARDAKTVTKEIEIKGLWPTNVGELQLDWDSNNEIQTFEVTLALDYWE

Entity 9 Entity 9 polymer

Description description	Baseplate wedge protein gp25
Molecular weight formula_weight	15111.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,q,BD,DG,FJ,IC

MANINKLYSDIDPEMKMDWNKDVSRSLGLRSIKNSLLGIITTRKGSRPFDPEFGCDLSDQLFENMTPLTADTVERNIESAVRNYEPRIDKLAVNVIPVYDDYTLIVEIRFSVIDNPDDIEQIKLQLASSNRV

Entity 10 Entity 10 polymer

Description description	Baseplate tail-tube protein gp48
Molecular weight formula_weight	39770.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,r,BE,DH,GA,ID

MAIVKEITADLIKKSGEKISAGQSTKSEVGTKTYTAQFPTGRASGNDTTEDFQVTDLYKNGLLFTAYNMSSRDSGSLRSMRSNYSSSSSSILRTARNTISSTVSKLSNGLISNNNSGTISKSPIANILLPRSKSDVDTSSHRFNDVQESLISRGGGTATGVLSNIASTAVFGALESITQGIMADNNEQIYTTARSMYGGAENRTKVFTWDLTPRSTEDLMAIINIYQYFNYFSYGETGKSQYAAEIKGYLDDWYRSTLIEPLSPEDAAKNKTLFEKMTSSLTNVLVVSNPTVWMVKNFGATSKFDGKTEIFGPCQIQSIRFDKTPNGNFNGLAIAPNLPSTFTLEITMREIITLNRASLYAGTF

Entity 11 Entity 11 polymer

Description description	Baseplate wedge protein gp53
Molecular weight formula_weight	22990.9 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,s,BF,DI,GB,IE

MLFTFFDPIEYAAKTVNKNAPTIPMTDIFRNYKDYFKRALAGYRLRTYYIKGSPRPEELANAIYGNPQLYWVLLMCNDNYDPYYGWITSQEAAYQASIQKYKNVGGDQIVYHVNENGEKFYNLISYDDNPYVWYDKGDKARKYPQYEGALAAVDTYEAAVLENEKLRQIKIIAKSDINSFMNDLIRIMEKSYGNDK

Entity 12 Entity 12 polymer

Description description	Baseplate tail-tube protein gp54
Molecular weight formula_weight	35001.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,t,BG,DJ,GC,IF

MYSLEEFNNQAINADFQRNNMFSCVFATTPSTKSSSLISSISNFSYNNLGLNSDWLGLTQGDINQGITTLITAGTQKLIRKSGVSKYLIGAMSQRTVQSLLGSFTVGTYLIDFFNMAYNSSGLMIYSVKMPENRLSYETDWNYNSPNIRITGRELDPLVISFRMDSEACNYRAMQDWVNSVQDPVTGLRALPQDVEADIQVNLHSRNGLPHTAVMFTMHSISVSAPELSYDGDNQITTFDVTFAYRVMQAGAVDRQRALEWLESAAINGIQSVLGNSGGVTGLSNSLSRLSRLGGTAGSISNINTMTGIVNSQSKILGAI

Entity 13 Entity 13 polymer

Description description	Peptidoglycan hydrolase gp5
Molecular weight formula_weight	63183.7 kDa
EC 编号 ec_number	3.2.1.17
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YA,YB,YC

MEMISNNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKTPARSLSAMAATVAKSSDPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG

Entity 14 Entity 14 polymer

Description description	Baseplate hub protein gp27
Molecular weight formula_weight	44431.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YD,YE,YF

MSMLQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPSLIGQFIQELKYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEFKSDTTTEESSSSNKQ

Entity 15 Entity 15 polymer

Description description	Uncharacterized 10.2 kDa protein in segC-Gp6 intergenic region
Molecular weight formula_weight	10233.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ZA

MSGLSYDKCVTAGHEAWPPTVVNATQSKVFTGGIAVLVAGDPITEHTEIKKPYETHGGVTQPRTSKVYVTGKKAVQMADPISCGDTVAQASSKVFIK

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 17 Entity 17 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.11 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	37913

Cryo-electron microscopy structure of the hexagonal pre-attachment T4 baseplate-tail tube complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate wedge protein gp6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Short tail fiber protein gp12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube protein gp19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge protein gp25

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate tail-tube protein gp48

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer