SAXSdb — 4osd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail-associated lysozyme

Enterobacteria phage T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	Elaidic acid × 3 MAGNESIUM ION × 2 STEARIC ACID × 2 PALMITIC ACID × 1 water × 6	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 6	Elaidic acid × 2 MAGNESIUM ION × 2 STEARIC ACID × 2 PALMITIC ACID × 2 water × 6	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 6	Elaidic acid × 2 MAGNESIUM ION × 2 STEARIC ACID × 2 PALMITIC ACID × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VG05_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–95； UniProt 484–575 Author chain B； PDBConstruct 4–95； UniProt 484–575 Author chain C； PDBConstruct 4–95； UniProt 484–575 Author chain D； PDBConstruct 4–95； UniProt 484–575 Author chain E； PDBConstruct 4–95； UniProt 484–575 Author chain F； PDBConstruct 4–95； UniProt 484–575 Author chain G； PDBConstruct 4–95； UniProt 484–575 Author chain H； PDBConstruct 4–95； UniProt 484–575 Author chain I； PDBConstruct 4–95； UniProt 484–575 Author chain J； PDBConstruct 4–95； UniProt 484–575 Author chain K； PDBConstruct 4–95； UniProt 484–575 Author chain L； PDBConstruct 4–95； UniProt 484–575 Author chain M； PDBConstruct 4–95； UniProt 484–575 Author chain N； PDBConstruct 4–95； UniProt 484–575 Author chain O； PDBConstruct 4–95； UniProt 484–575 Author chain P； PDBConstruct 4–95； UniProt 484–575 Author chain Q； PDBConstruct 4–95； UniProt 484–575 Author chain R； PDBConstruct 4–95； UniProt 484–575

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4osd
Deposition date deposition_date	2014-02-12
Structure title title	Dimer of a C-terminal fragment of phage T4 gp5 beta-helix
Keywords keywords	;membrane piercing, T4 gp5, triple beta-helix, SDS resistant, donor strand exchange, fragment, membrane piercing complex, gp5.4, gp27-gp5 complex, HYDROLASE ;; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4osd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4osd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4osd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.47 Å
Rg (electron density)	35.91 Å
Total Rg	36.04 Å
Atom count	4174
Residues	558
Excluded volume	73852 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4osd__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4osd__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4osd__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Tail-associated lysozyme
Molecular weight formula_weight	9799.6 kDa
EC 编号 ec_number	3.2.1.17
Source method src_method	man
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R
Atom count atom_count	13209

SGSGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	Elaidic acid
Molecular weight formula_weight	282.5 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	STEARIC ACID
Molecular weight formula_weight	284.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	638

▶

Unit-cell length a length_a	110.288 Å
Unit-cell length b length_b	73.786 Å
Unit-cell length c length_c	111.602 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	113.39 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.960 Å
Low-resolution limit resolution_low	59.870 Å
R factor r_factor	0.2223
R_work r_work	0.2193
R_free r_free	0.2785

Dimer of a C-terminal fragment of phage T4 gp5 beta-helix

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail-associated lysozyme

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4osd__assembly_1__model_1

4osd__assembly_1__model_1 | I(q)

4osd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Dimer of a C-terminal fragment of phage T4 gp5 beta-helix

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail-associated lysozyme

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4osd__assembly_1__model_1

4osd__assembly_1__model_1 | I(q)

4osd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)