SAXSdb — 3a1m

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin

Enterobacteria phage T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 6	POTASSIUM ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	WAC_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 105–131； UniProt 458–484 Author chain B； PDBConstruct 105–131； UniProt 458–484 Author chain C； PDBConstruct 105–131； UniProt 458–484 Author chain D； PDBConstruct 105–131； UniProt 458–484 Author chain E； PDBConstruct 105–131； UniProt 458–484 Author chain F； PDBConstruct 105–131； UniProt 458–484

chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin

Enterobacteria phage T4

UniProt P16009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 6	POTASSIUM ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VG05_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 16–101； UniProt 490–575 Author chain B； PDBConstruct 16–101； UniProt 490–575 Author chain C； PDBConstruct 16–101； UniProt 490–575 Author chain D； PDBConstruct 16–101； UniProt 490–575 Author chain E； PDBConstruct 16–101； UniProt 490–575 Author chain F； PDBConstruct 16–101； UniProt 490–575

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3a1m
Deposition date deposition_date	2009-04-11
Structure title title	A fusion protein of a beta helix region of gene product 5 and the foldon region of bacteriophage T4
Keywords keywords	bacteriophage T4, Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase, Late protein, Chaperone, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3a1m__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3a1m__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3a1m__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.13 Å
Rg (electron density)	37.15 Å
Total Rg	36.81 Å
Atom count	4352
Residues	590
Excluded volume	76440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3a1m__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin
Molecular weight formula_weight	14850.3 kDa
EC 编号 ec_number	3.2.1.17
Mutation mutation	V16L
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	4820

GSMAISDPPNSSSVPLEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIGSVEGYIPEAPRDGQAYVRKDGEWVFLSTFLVEHHHHHH

Source Source

Source organism organism	Enterobacteria phage T4
Common name common_name	Bacteriophage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	377

▶

Unit-cell length a length_a	98.814 Å
Unit-cell length b length_b	57.010 Å
Unit-cell length c length_c	136.594 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.90 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	29.170 Å
R factor r_factor	0.2249
R_work r_work	0.2226
R_free r_free	0.2683

A fusion protein of a beta helix region of gene product 5 and the foldon region of bacteriophage T4

1. Protein Identity and Related Structures Protein Identity & Related Structures

chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3a1m__assembly_1__model_1

3a1m__assembly_1__model_1 | I(q)

3a1m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

A fusion protein of a beta helix region of gene product 5 and the foldon region of bacteriophage T4

1. Protein Identity and Related Structures Protein Identity & Related Structures

chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

chimera of thrombin cleavage site, Tail-associated lysozyme, Fibritin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3a1m__assembly_1__model_1

3a1m__assembly_1__model_1 | I(q)

3a1m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)