6p1z

Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with the C-terminal part of the T4 gp5 beta-helical domain

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate central spike complex protein gp5

Enterobacteria phage T4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	PAAR-repeat central spike tip protein × 1 （L7T0L4） MAGNESIUM ION × 1 PALMITIC ACID × 1 STEARIC ACID × 1 Elaidic acid × 1 ZINC ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	PAAR-repeat central spike tip protein × 1 （L7T0L4） MAGNESIUM ION × 1 PALMITIC ACID × 1 STEARIC ACID × 1 Elaidic acid × 1 ZINC ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BP5_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–96； UniProt 484–575 Author chain B； PDBConstruct 5–96； UniProt 484–575 Author chain C； PDBConstruct 5–96； UniProt 484–575 Author chain E； PDBConstruct 5–96； UniProt 484–575 Author chain F； PDBConstruct 5–96； UniProt 484–575 Author chain G； PDBConstruct 5–96； UniProt 484–575

PAAR-repeat central spike tip protein

Pseudomonas phage phiKZ

UniProt L7T0L4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Baseplate central spike complex protein gp5 × 3 （P16009） MAGNESIUM ION × 1 PALMITIC ACID × 1 STEARIC ACID × 1 Elaidic acid × 1 ZINC ION × 1 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Baseplate central spike complex protein gp5 × 3 （P16009） MAGNESIUM ION × 1 PALMITIC ACID × 1 STEARIC ACID × 1 Elaidic acid × 1 ZINC ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L7T0L4_BPDPK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–88； UniProt 1–88 Author chain H； PDBConstruct 1–88； UniProt 1–88

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6p1z
Deposition date deposition_date	2019-05-20
Structure title title	Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with the C-terminal part of the T4 gp5 beta-helical domain
Keywords keywords	;bacteriophage, phiKZ, membrane piercing, central spike, cell puncturing device, PAAR-repeat motif, beta helix, T4 gp5, Pseudomonas aeruginosa, contractile injection system, viral protein, hydrolase ;; viral protein, hydrolase
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6p1z__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6p1z__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6p1z__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.49 Å
Rg (electron density)	25.26 Å
Total Rg	25.99 Å
Atom count	5309
Residues	363
Excluded volume	47354 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6p1z__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6p1z__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Baseplate central spike complex protein gp5
Molecular weight formula_weight	9856.7 kDa
EC 编号 ec_number	3.2.1.17
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,E,F,G
Atom count atom_count	11666

GSGSGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG

Source Source

Source organism organism	Enterobacteria phage T4
NCBI taxonomy ID ncbi_taxonomy_id	10665
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	PAAR-repeat central spike tip protein
Molecular weight formula_weight	8809.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H

MPGIAVCNMDSAGGVILPGPNVKCFYKGQPFAVIGCAVAGHGRTPHDSARMIQGSVKMAIAGIPVCLQGSMASCGHTATGRPNLTCGS

Source Source

Source organism organism	Pseudomonas phage phiKZ
NCBI taxonomy ID ncbi_taxonomy_id	169683
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	STEARIC ACID
Molecular weight formula_weight	284.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	Elaidic acid
Molecular weight formula_weight	282.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	928

▶

Unit-cell length a length_a	72.275 Å
Unit-cell length b length_b	69.123 Å
Unit-cell length c length_c	77.802 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	102.48 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.099 Å
Low-resolution limit resolution_low	44.597 Å
R factor r_factor	0.1900
R_work r_work	0.1877
R_free r_free	0.2514

Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with the C-terminal part of the T4 gp5 beta-helical domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate central spike complex protein gp5

State in the Current Structure

Other States of the Same Protein in the Database

PAAR-repeat central spike tip protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6p1z__assembly_1__model_1

6p1z__assembly_1__model_1 | I(q)

6p1z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (3)

Bacteriophage phiKZ gp163.1 PAAR repeat protein in complex with the C-terminal part of the T4 gp5 beta-helical domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate central spike complex protein gp5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PAAR-repeat central spike tip protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6p1z__assembly_1__model_1

6p1z__assembly_1__model_1 | I(q)

6p1z__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Citations (3)