5w1k

JUNV GP1 CR1-10 Fab CR1-28 Fab complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CR1-28 Fab light chain

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
3	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
4	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IGK_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 103–206； UniProt 109–212 Author chain F； PDBConstruct 103–206； UniProt 109–212 Author chain K； PDBConstruct 103–206； UniProt 109–212 Author chain S； PDBConstruct 103–206； UniProt 109–212

CR1-28 Fab heavy chain

Homo sapiens

UniProt S6C4R2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
3	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
4	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S6C4R2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 127–226； UniProt 142–241 Author chain G； PDBConstruct 127–226； UniProt 142–241 Author chain L； PDBConstruct 127–226； UniProt 142–241 Author chain T； PDBConstruct 127–226； UniProt 142–241

CR1-10 Fab light chain

Homo sapiens

UniProt Q6PIL8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
3	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
4	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab heavy chain × 1 （S6B2B6） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6PIL8_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 106–213； UniProt 128–235 Author chain H； PDBConstruct 106–213； UniProt 128–235 Author chain M； PDBConstruct 106–213； UniProt 128–235 Author chain N； PDBConstruct 106–213； UniProt 128–235

CR1-10 Fab heavy chain

Homo sapiens

UniProt S6B2B6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
3	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） Pre-glycoprotein polyprotein GP complex × 1 （P26313） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
4	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） Pre-glycoprotein polyprotein GP complex × 1 （P26313） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S6B2B6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 126–225； UniProt 146–245 Author chain I； PDBConstruct 126–225； UniProt 146–245 Author chain O； PDBConstruct 126–225； UniProt 146–245 Author chain Q； PDBConstruct 126–225； UniProt 146–245

Pre-glycoprotein polyprotein GP complex

Junin mammarenavirus

UniProt P26313

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
2	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
3	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count
4	Other combination	Heteromer	Protein 5 其他Polymer 1	CR1-28 Fab light chain × 1 （P0DOX7） CR1-28 Fab heavy chain × 1 （S6C4R2） CR1-10 Fab light chain × 1 （Q6PIL8） CR1-10 Fab heavy chain × 1 （S6B2B6） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLYC_JUNIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–142； UniProt 87–228 Author chain J； PDBConstruct 1–142； UniProt 87–228 Author chain P； PDBConstruct 1–142； UniProt 87–228 Author chain R； PDBConstruct 1–142； UniProt 87–228

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5w1k
Deposition date deposition_date	2017-06-03
Structure title title	JUNV GP1 CR1-10 Fab CR1-28 Fab complex
Keywords keywords	Fab, antibody, Junin virus, arenavirus, viral protein, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5w1k__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5w1k__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5w1k__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.49 Å
Rg (electron density)	43.00 Å
Total Rg	43.21 Å
Atom count	7788
Residues	1010
Excluded volume	137790 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5w1k__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5w1k__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5w1k__assembly_3__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`5w1k__assembly_4__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	CR1-28 Fab light chain
Molecular weight formula_weight	22621.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F,K,S
Atom count atom_count	31130

IQMTQSPSTLSASVGDRVTITCRASQSIDNWLAWYQQKPGKAPKLLIYTASRLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	CR1-28 Fab heavy chain
Molecular weight formula_weight	24168.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G,L,T

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSSAMHWVRQAPGKGLEWVAVIWSDGSNENYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCATDKTYVSGYTSTWYYFNYWGQGTLVTVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	CR1-10 Fab light chain
Molecular weight formula_weight	23149.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H,M,N

IVLTQSPGTLSLSPGETATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASGRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGRSGYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	CR1-10 Fab heavy chain
Molecular weight formula_weight	23785.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I,O,Q

VQLQESGPGLVKPSQTLSLTCSVSGGSIGGSSYYWSWIRHHPGKGLEWIGYINYRGITHYNAALKSRVSMSVETSQNHFSLQLTSVTAADTAVYYCARLTSDCSGGNCYQAFDYWGQGSLVSVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Pre-glycoprotein polyprotein GP complex
Molecular weight formula_weight	16425.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,J,P,R

DLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPL

Source Source

Source organism organism	Junin mammarenavirus
Common name common_name	JUNV
NCBI taxonomy ID ncbi_taxonomy_id	11619
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	3

Entity 7 Entity 7 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 24 domains

CATH v4.4 (24 domains)

Domain ID domain_id	5w1kA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kF01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kF02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kG02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kI02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kK01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kK02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kL02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kM01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kM02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kN01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kN02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kO02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kQ02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kS01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kS02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	5w1kT02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	154.840 Å
Unit-cell length b length_b	132.230 Å
Unit-cell length c length_c	167.420 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.47 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.990 Å
Low-resolution limit resolution_low	49.350 Å
R factor r_factor	0.2390
R_work r_work	0.2370
R_free r_free	0.2880

JUNV GP1 CR1-10 Fab CR1-28 Fab complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

CR1-28 Fab light chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CR1-28 Fab heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CR1-10 Fab light chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CR1-10 Fab heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-glycoprotein polyprotein GP complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5w1k__assembly_1__model_1

5w1k__assembly_1__model_1 | I(q)

5w1k__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 branched

Entity 7 Entity 7 branched

Entity 8 Entity 8 non-polymer

6. Fold Classification (SCOP + CATH) 24 domains

CATH v4.4 (24 domains)

7. Citations (1)