9mew

JUNV GP1, GP2, SSP and CR1-28 Fab complex in a pseudotyped virus membrane

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-glycoprotein polyprotein GP complex

Mammarenavirus juninense

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 其他Polymer 6	CR1-28 Fab Light Chain × 3 CR1-28 Fab Heavy Chain × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MYRISTIC ACID × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLYC_JUNIN
Isoform	—
PDB entities	1, 2, 3
Chains and sequence ranges	Author chain A； PDBConstruct 1–58； UniProt 1–58 Author chain F； PDBConstruct 1–58； UniProt 1–58 Author chain K； PDBConstruct 1–58； UniProt 1–58 Author chain B； PDBConstruct 1–193； UniProt 59–251 Author chain G； PDBConstruct 1–193； UniProt 59–251 Author chain L； PDBConstruct 1–193； UniProt 59–251 Author chain C； PDBConstruct 1–234； UniProt 252–485 Author chain H； PDBConstruct 1–234； UniProt 252–485 Author chain M； PDBConstruct 1–234； UniProt 252–485

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mew
Deposition date deposition_date	2024-12-09
Last revision last_revision	2025-07-23
Structure title title	JUNV GP1, GP2, SSP and CR1-28 Fab complex in a pseudotyped virus membrane
Keywords keywords	;Viral protein, Glycoprotein, GPC, JUNV, Junin mammarenavirus, GP1, GP2, signal peptide, virus membrane, CR1-28 Fab, VIRAL PROTEIN-IMMUNE SYSTEM complex ;; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9mew__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9mew__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9mew__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.86 Å
Rg (electron density)	62.71 Å
Total Rg	62.60 Å
Atom count	21744
Residues	2703
Excluded volume	387650 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9mew__assembly_1__model_1`	15-meric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Pre-glycoprotein polyprotein GP complex
Molecular weight formula_weight	6373.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F,K
Atom count atom_count	21744

MGQFISFMQEIPTFLQEALNIALVAVSLIAIIKGVVNLYKSGLFQFFVFLALAGRSCT

Source Source

Source organism organism	Mammarenavirus juninense
NCBI taxonomy ID ncbi_taxonomy_id	2169991
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	JUNV GP1
Molecular weight formula_weight	22311.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G,L

EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSLK

Source Source

Source organism organism	Mammarenavirus juninense
NCBI taxonomy ID ncbi_taxonomy_id	2169991
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	JUNV GP2
Molecular weight formula_weight	27026.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H,M

AFFSWSLTDSSGKDTPGGYCLEEWMLVAAKMKCFGNTAVAKCNLNHDSEFCDMLRLFDYNKNAIKTLNDETKKQVNLMGQTINALISDNLLMKNKIRELMSVPYCNYTKFWYVNHTLSGQHSLPRCWLIKNNSYLNISDFRNDWILESDFLISEMLSKEYSDRQGKTPLTLVDICFWSTVFFTASLFLHLVGIPTHRHIRGEACPLPHRLNSLGGCRCGKYPNLKKPTVWRRGH

Source Source

Source organism organism	Mammarenavirus juninense
NCBI taxonomy ID ncbi_taxonomy_id	2169991
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	CR1-28 Fab Light Chain
Molecular weight formula_weight	22621.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I,N

IQMTQSPSTLSASVGDRVTITCRASQSIDNWLAWYQQKPGKAPKLLIYTASRLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQHRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	CR1-28 Fab Heavy Chain
Molecular weight formula_weight	24168.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,J,O

QVQLVESGGGVVQPGRSLRLSCAASGFTFSSSAMHWVRQAPGKGLEWVAVIWSDGSNENYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCATDKTYVSGYTSTWYYFNYWGQGTLVTVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 8 Entity 8 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	15

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	397489

JUNV GP1, GP2, SSP and CR1-28 Fab complex in a pseudotyped virus membrane

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-glycoprotein polyprotein GP complex

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mew__assembly_1__model_1

9mew__assembly_1__model_1 | I(q)

9mew__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)

JUNV GP1, GP2, SSP and CR1-28 Fab complex in a pseudotyped virus membrane

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-glycoprotein polyprotein GP complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mew__assembly_1__model_1

9mew__assembly_1__model_1 | I(q)

9mew__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)