5xtb

Cryo-EM structure of human respiratory complex I matrix arm

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

OrganismNot specified

UniProt O00217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–176； UniProt 35–210

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

OrganismNot specified

UniProt O75251

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–156； UniProt 58–213

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

OrganismNot specified

UniProt P56556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–113； UniProt 42–154

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt O43678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–83； UniProt 14–96

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt O14561

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 72–156

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

OrganismNot specified

UniProt Q16718

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA5_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–112； UniProt 5–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

OrganismNot specified

UniProt O95182

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–110； UniProt 4–113

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

OrganismNot specified

UniProt Q16795

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–337； UniProt 40–376

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

OrganismNot specified

UniProt P56181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV3_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–33； UniProt 74–106

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt O43181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS4_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–118； UniProt 58–175

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

OrganismNot specified

UniProt P28331

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–687； UniProt 30–716

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt Q9UI09

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAC_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–143； UniProt 2–144

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

OrganismNot specified

UniProt P19404

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV2_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–212； UniProt 36–247

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

OrganismNot specified

UniProt O75489

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS3_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain P； PDBConstruct 1–208； UniProt 43–250

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

UniProt O75306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 1–385； UniProt 79–463

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

OrganismNot specified

UniProt O75380

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS6_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–95； UniProt 29–123

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

OrganismNot specified

UniProt Q9P0J0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAD_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain W； PDBConstruct 1–22； UniProt 7–28

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5xtb
Deposition date deposition_date	2017-06-18
Structure title title	Cryo-EM structure of human respiratory complex I matrix arm
Keywords keywords	Respiratory, OXIDOREDUCTASE-ELECTRON TRANSPORT complex; OXIDOREDUCTASE/ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5xtb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5xtb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5xtb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.09 Å
Rg (electron density)	49.18 Å
Total Rg	49.13 Å
Atom count	27962
Residues	3491
Excluded volume	498880 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5xtb__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	47323.9 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	27962

PKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQH

Entity 2 Entity 2 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
Molecular weight formula_weight	20314.0 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 3 Entity 3 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Molecular weight formula_weight	17887.9 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

Entity 4 Entity 4 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Molecular weight formula_weight	13758.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

FVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 5 Entity 5 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	9535.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

LGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLS

Entity 6 Entity 6 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	9845.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

PPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 7 Entity 7 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Molecular weight formula_weight	13119.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

LKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Entity 8 Entity 8 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
Molecular weight formula_weight	12282.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

ATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Molecular weight formula_weight	38387.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVN

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
Molecular weight formula_weight	3900.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

LQHHDYSTYTFLDLNLELSKFRMPQPSSGRESP

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	13721.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

KLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 12 Entity 12 polymer

Description description	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Molecular weight formula_weight	75471.5 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

NLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTE

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	16880.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

ELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPY

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Molecular weight formula_weight	23430.9 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

GALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQA

Entity 15 Entity 15 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Molecular weight formula_weight	24432.7 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

TRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPE

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	43987.6 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

NITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Molecular weight formula_weight	10578.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHH

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	2561.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

KQDMPPPGGYGPIDYKRNLPRR

Entity 19 Entity 19 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 20 Entity 20 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate
Molecular weight formula_weight	540.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 23 Entity 23 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

Domain ID domain_id	5xtbA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11540 — NADH-ubiquinone oxidoreductase 51kDa subunit

Domain ID domain_id	5xtbA03
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	600 —

Domain ID domain_id	5xtbA04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	230 — NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain

Domain ID domain_id	5xtbB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3270 —

Domain ID domain_id	5xtbC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	12280 —

Domain ID domain_id	5xtbF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	5xtbQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	167761

Cryo-EM structure of human respiratory complex I matrix arm

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acyl carrier protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer