5xtb

Cryo-EM structure of human respiratory complex I matrix arm

Method: ELECTRON MICROSCOPY D_max: 162.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain A； UniProt 27–457	Fragment：UNP RESIDUES 27-457	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 27–457（431 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain A 27–457（431 aa） Fragment：UNP RESIDUES 27-457	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain A 27–457（431 aa） Fragment：UNP RESIDUES 27-457 Chain BA 27–457（431 aa） Fragment：UNP RESIDUES 27-457	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 1–464（464 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain C 1–464（464 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain C 27–460（434 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUV1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–431； UniProt 27–457

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

OrganismNot specified

UniProt O00217

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain B； UniProt 35–210	Not recorded	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain B 35–210（176 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain B 35–210（176 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain B 35–210（176 aa） Chain BB 35–210（176 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain B 1–210（210 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain D 1–210（210 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain D 35–210（176 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–176； UniProt 35–210

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

OrganismNot specified

UniProt O75251

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain C； UniProt 58–213	Fragment：UNP RESIDUES 58-213	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain C 58–213（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain C 58–213（156 aa） Fragment：UNP RESIDUES 58-213	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BC 58–213（156 aa） Fragment：UNP RESIDUES 58-213 Chain C 58–213（156 aa） Fragment：UNP RESIDUES 58-213	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain C 1–213（213 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain E 1–213（213 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain E 53–213（161 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–156； UniProt 58–213

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

OrganismNot specified

UniProt P56556

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain E； UniProt 42–154	Fragment：UNP RESIDUES 42-154	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain E 42–154（113 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain E 42–154（113 aa） Fragment：UNP RESIDUES 42-154	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BE 42–154（113 aa） Fragment：UNP RESIDUES 42-154 Chain E 42–154（113 aa） Fragment：UNP RESIDUES 42-154	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain E 1–128（128 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain F 1–128（128 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain F 11–128（118 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUA6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–113； UniProt 42–154

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt O43678

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain F； UniProt 14–96	Fragment：UNP RESIDUES 14-96	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1S3A NMR Solution Structure of Subunit B8 from Human NADH-Ubiquinone Oxidoreductase Complex I (CI-B8) Deposited 2004-01-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 0–98（99 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；300 K；Ionic strength (raw mmCIF value) 20mM phosphate, 50mM NaCl；Pressure ambient NMR sample composition U-15N, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition U-15N, U-13C, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition U-15N, U-13C, 100% D2O \| 100% D2O	Resolution not provided
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain F 14–96（83 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain F 14–96（83 aa） Fragment：UNP RESIDUES 14-96	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BF 14–96（83 aa） Fragment：UNP RESIDUES 14-96 Chain F 14–96（83 aa） Fragment：UNP RESIDUES 14-96	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain F 1–99（99 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain G 1–99（99 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain G 14–98（85 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUA2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–83； UniProt 14–96

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt O14561

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain G； UniProt 72–156	Not recorded	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2DNW Solution structure of RSGI RUH-059, an ACP domain of acyl carrier protein, mitochondrial [Precursor] from human cDNA Deposited 2006-04-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 69–156（88 aa） Fragment：acyl carrier protein	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 0.91mM RSGI RUH-059 U-15N, 13C; 20mM d-Tris-HCl; 1mM d-DTT; 0.02% NaN3; 10% D2O, 90% H2O \| 90% H2O/10% D2O	Resolution not provided
5OOL Structure of a native assembly intermediate of the human mitochondrial ribosome with unfolded interfacial rRNA Deposited 2017-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 54 PDB declaration: 56-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 92 ZN ZINC ION × 3 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.45；2 mM Synercid (Santa Cruz Biotechnology, Inc) was added to reduce preferential orientation. cryo-EM vitrification conditions Cryogen ETHANE；Sample incubated for 30 s prior to freezing.	Resolution 3.06 Å
5OOM Structure of a native assembly intermediate of the human mitochondrial ribosome with unfolded interfacial rRNA Deposited 2017-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 55-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 49 ZN ZINC ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.45；2 mM Synercid (Santa Cruz Biotechnology, Inc) was added to reduce preferential orientation. cryo-EM vitrification conditions Cryogen ETHANE；Sample incubated for 30 s prior to freezing.	Resolution 3.03 Å
5XTC Cryo-EM structure of human respiratory complex I transmembrane arm Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain X 72–156（85 aa）	Not recorded	PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain G 72–156（85 aa） Chain X 72–156（85 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain G 72–156（85 aa） Fragment：UNP RESIDUES 72-156 Chain X 72–156（85 aa） Fragment：UNP RESIDUES 72-156	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BG 72–156（85 aa） Fragment：UNP RESIDUES 72-196 Chain BX 72–156（85 aa） Fragment：UNP RESIDUES 72-196 Chain G 72–156（85 aa） Fragment：UNP RESIDUES 72-196 Chain X 72–156（85 aa） Fragment：UNP RESIDUES 72-196	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
6ODD Crystal structure of the human complex ACP-ISD11 Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 72–156（85 aa）	Not recorded	8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；The drop was a 1:1 mix of protein (in 10 mM Tris buffer, 25 mM NaCl, pH 7.5) and reservoir solution (0.1 M Tris pH 9.1, 0.1 M CaCl2, 23% tert-butanol)	Resolution 2.00 Å R-free 0.216
6ODD Crystal structure of the human complex ACP-ISD11 Deposited 2019-03-26	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 72–156（85 aa）	Not recorded	8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；The drop was a 1:1 mix of protein (in 10 mM Tris buffer, 25 mM NaCl, pH 7.5) and reservoir solution (0.1 M Tris pH 9.1, 0.1 M CaCl2, 23% tert-butanol)	Resolution 2.00 Å R-free 0.216
7A5H Structure of the split human mitoribosomal large subunit with rescue factors mtRF-R and MTRES1 Deposited 2020-08-21	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 59-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 92 ZN ZINC ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7A5J Structure of the split human mitoribosomal large subunit with P-and E-site mt-tRNAs Deposited 2020-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 63-meric	Chain w 1–156（156 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 92 ZN ZINC ION × 3 CL CHLORIDE ION × 2 NA SODIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7O9K Human mitochondrial ribosome large subunit assembly intermediate with MTERF4-NSUN4, MRM2, MTG1, the MALSU module, GTPBP5 and mtEF-Tu Deposited 2021-04-16	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 67 PDB declaration: 69-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 93 SAM S-ADENOSYLMETHIONINE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7O9M Human mitochondrial ribosome large subunit assembly intermediate with MTERF4-NSUN4, MRM2, MTG1 and the MALSU module Deposited 2021-04-16	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 66-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 104 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ZN ZINC ION × 2 SAM S-ADENOSYLMETHIONINE × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
7ODR State A of the human mitoribosomal large subunit assembly intermediate Deposited 2021-04-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 57-meric	Chain w 1–156（156 aa）	Not recorded	PM8 S-(2-{[N-(2-HYDROXY-4-{[HYDROXY(OXIDO)PHOSPHINO]OXY}-3,3-DIMETHYLBUTANOYL)-BETA-ALANYL]AMINO}ETHYL) DECANETHIOATE × 1 SAM S-ADENOSYLMETHIONINE × 1 ZN ZINC ION × 2 MG MAGNESIUM ION × 97 K POTASSIUM ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；4 uL of the sample was blotted for 2-6 sec before plunging	Resolution 2.90 Å
7ODS State B of the human mitoribosomal large subunit assembly intermediate Deposited 2021-04-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	PM8 S-(2-{[N-(2-HYDROXY-4-{[HYDROXY(OXIDO)PHOSPHINO]OXY}-3,3-DIMETHYLBUTANOYL)-BETA-ALANYL]AMINO}ETHYL) DECANETHIOATE × 1 SAM S-ADENOSYLMETHIONINE × 1 ZN ZINC ION × 2 MG MAGNESIUM ION × 88 K POTASSIUM ION × 8 N ANY 5'-MONOPHOSPHATE NUCLEOTIDE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；4 uL of the sample was blotted for 2-6 sec before plunging	Resolution 3.10 Å
7ODT State C of the human mitoribosomal large subunit assembly intermediate Deposited 2021-04-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 95 PM8 S-(2-{[N-(2-HYDROXY-4-{[HYDROXY(OXIDO)PHOSPHINO]OXY}-3,3-DIMETHYLBUTANOYL)-BETA-ALANYL]AMINO}ETHYL) DECANETHIOATE × 1 SAM S-ADENOSYLMETHIONINE × 1 ZN ZINC ION × 2 K POTASSIUM ION × 10 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；4 uL of the sample was blotted for 2-6 sec before plunging	Resolution 3.10 Å
7OF0 Structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with MTERF4-NSUN4 (dataset1). Deposited 2021-05-04	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 54 PDB declaration: 56-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 61	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.20 Å
7OF2 Structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with GTPBP6. Deposited 2021-05-04	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 54 PDB declaration: 56-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 85 GTP GUANOSINE-5'-TRIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7OF3 Structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with MTERF4-NSUN4 (dataset2). Deposited 2021-05-04	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 54 PDB declaration: 56-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 58 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7OF5 Structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with MTERF4-NSUN4 and GTPBP5 (dataset2). Deposited 2021-05-04	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 57-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 70 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7OF7 Structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with MTERF4-NSUN4 and GTPBP5 (dataset1). Deposited 2021-05-04	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 57-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 3 MG MAGNESIUM ION × 74	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7OI6 Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 1 Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 50 PDB declaration: 52-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 48 ZN ZINC ION × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.70 Å
7OI7 Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 2 Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 54-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 49 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7OI8 Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 3A Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 55-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 49 ZN ZINC ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7OI9 Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 3B Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 52 PDB declaration: 54-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 49 ZN ZINC ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7OIC Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 4 Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 55 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 76 ZN ZINC ION × 3 PNS 4'-PHOSPHOPANTETHEINE × 1 SAM S-ADENOSYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7OID Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 5A Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 56-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7OIE Cryo-EM structure of late human 39S mitoribosome assembly intermediates, state 5B Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 55-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7PD3 Structure of the human mitoribosomal large subunit in complex with NSUN4.MTERF4.GTPBP7 and MALSU1.L0R8F8.mt-ACP Deposited 2021-08-04	Different construct Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 60-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 91 PNS 4'-PHOSPHOPANTETHEINE × 1 SAM S-ADENOSYLMETHIONINE × 1 GCP PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7PO4 Assembly intermediate of human mitochondrial ribosome large subunit (largely unfolded rRNA with MALSU1, L0R8F8 and ACP) Deposited 2021-09-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 60-meric	Chain zc 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 35 K POTASSIUM ION × 8 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.56 Å
7QH6 Cryo-EM structure of the human mtLSU assembly intermediate upon MRM2 depletion - class 1 Deposited 2021-12-10	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 44 PDB declaration: 46-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.08 Å
7QH7 Cryo-EM structure of the human mtLSU assembly intermediate upon MRM2 depletion - class 4 Deposited 2021-12-10	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 47 PDB declaration: 49-meric	Chain w 74–152（79 aa）	Not recorded	MG MAGNESIUM ION × 50 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å
8K2B Cryo-EM structure of the human 39S mitoribosome with Tigecycline Deposited 2023-07-12	Different construct Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 55-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 95 T1C TIGECYCLINE × 1 ZN ZINC ION × 3 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8PK0 human mitoribosomal large subunit assembly intermediate 1 with GTPBP10-GTPBP7 Deposited 2023-06-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 1 PM8 S-(2-{[N-(2-HYDROXY-4-{[HYDROXY(OXIDO)PHOSPHINO]OXY}-3,3-DIMETHYLBUTANOYL)-BETA-ALANYL]AMINO}ETHYL) DECANETHIOATE × 1 SAM S-ADENOSYLMETHIONINE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 96 K POTASSIUM ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.03 Å
8QSJ Human mitoribosomal large subunit assembly intermediate 2 with GTPBP7 Deposited 2023-10-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 38 FES FE2/S2 (INORGANIC) CLUSTER × 1 PM8 S-(2-{[N-(2-HYDROXY-4-{[HYDROXY(OXIDO)PHOSPHINO]OXY}-3,3-DIMETHYLBUTANOYL)-BETA-ALANYL]AMINO}ETHYL) DECANETHIOATE × 1 SAM S-ADENOSYLMETHIONINE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8QU5 mt-LSU assembly intermediate in GTPBP8 knock-out cells, state 2 Deposited 2023-10-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 53 PDB declaration: 55-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 48 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.42 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain G 1–156（156 aa） Chain X 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 1–156（156 aa） Chain X 1–156（156 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9N50 Crosslinked Crystal Structure of Human Mitochondrial Ketosynthase, OXSM, and Crosslinker-crypto Human Mitochondrial Acyl Carrier Protein, C8aBr-mACP Deposited 2025-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 69–156（88 aa）	Not recorded	A1BMZ N~3~-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-octanamidoethyl)-beta-alaninamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.5 M ammonium sulfate, 1 M lithium sulfate, and 0.1 M sodium citrate pH 5.6	Resolution 2.50 Å
9N51 Crosslinked Crystal Structure of Human Mitochondrial Ketosynthase, OXSM, and Crosslinker-crypto Human Mitochondrial Acyl Carrier Protein, C8Cl-mACP Deposited 2025-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 69–156（88 aa）	Not recorded	A1BMZ N~3~-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-octanamidoethyl)-beta-alaninamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.5 M ammonium sulfate, 1 M lithium sulfate, and 0.1 M sodium citrate pH 5.6	Resolution 2.31 Å R-free 0.273
9N51 Crosslinked Crystal Structure of Human Mitochondrial Ketosynthase, OXSM, and Crosslinker-crypto Human Mitochondrial Acyl Carrier Protein, C8Cl-mACP Deposited 2025-02-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 69–156（88 aa）	Not recorded	A1BMZ N~3~-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-octanamidoethyl)-beta-alaninamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.5 M ammonium sulfate, 1 M lithium sulfate, and 0.1 M sodium citrate pH 5.6	Resolution 2.31 Å R-free 0.273
9PRA In Situ Structure of the Human Mitoribosome Large Subunit 39S in Complex with EF-Tu Deposited 2025-07-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 64 PDB declaration: 66-meric	Chain Af 1–156（156 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 2 K POTASSIUM ION × 36 MG MAGNESIUM ION × 141 FES FE2/S2 (INORGANIC) CLUSTER × 1 SPD SPERMIDINE × 2 PUT 1,4-DIAMINOBUTANE × 1 VAL VALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.83 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 72–156（85 aa） Chain X 72–156（85 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

41 other PDB entries and 43 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACPM_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 72–156

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

OrganismNot specified

UniProt Q16718

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain H； UniProt 5–116	Not recorded	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 5–116（112 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain H 5–116（112 aa） Fragment：UNP RESIDUES 5-116	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BH 5–116（112 aa） Fragment：UNP RESIDUES 5-116 Chain H 5–116（112 aa） Fragment：UNP RESIDUES 5-116	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 1–116（116 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain I 1–116（116 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain I 5–116（112 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUA5_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–112； UniProt 5–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

OrganismNot specified

UniProt O95182

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain I； UniProt 4–113	Fragment：UNP RESIDUES 4-113	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain I 4–113（110 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain I 4–113（110 aa） Fragment：UNP RESIDUES 4-113	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BI 4–113（110 aa） Fragment：UNP RESIDUES 4-113 Chain I 4–113（110 aa） Fragment：UNP RESIDUES 4-113	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain I 1–113（113 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain t 1–113（113 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain t 1–113（113 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUA7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–110； UniProt 4–113

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

OrganismNot specified

UniProt Q16795

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain J； UniProt 40–376	Fragment：UNP RESIDUES 40-375	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 40–376（337 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain J 40–376（337 aa） Fragment：UNP RESIDUES 40-376	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BJ 40–376（337 aa） Fragment：UNP RESIDUES 40-376 Chain J 40–376（337 aa） Fragment：UNP RESIDUES 40-376	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–377（377 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 1–377（377 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain J 36–376（341 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUA9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–337； UniProt 40–376

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

OrganismNot specified

UniProt P56181

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain K； UniProt 74–106	Fragment：UNP RESIDUES 74-106	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 74–106（33 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain K 74–106（33 aa） Fragment：UNP RESIDUES 74-106	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BK 74–106（33 aa） Fragment：UNP RESIDUES 74-106 Chain K 74–106（33 aa） Fragment：UNP RESIDUES 74-106	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 1–108（108 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 1–108（108 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain K 68–106（39 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
9W2U Cryo-EM structure of complex I on the bovine heart submitochondrial particles, open Deposited 2025-07-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain s 64–108（45 aa）	Not recorded	FME N-FORMYLMETHIONINE × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 18 CDL CARDIOLIPIN × 6 CHD CHOLIC ACID × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9W2V Cryo-EM structure of complex I on the bovine heart submitochondrial particles, closed Deposited 2025-07-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain s 64–108（45 aa）	Not recorded	FME N-FORMYLMETHIONINE × 4 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 19 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 12 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 CDL CARDIOLIPIN × 6 MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUV3_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–33； UniProt 74–106

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt O43181

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain L； UniProt 58–175	Fragment：UNP RESIDUES 58-175	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain L 58–175（118 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain L 58–175（118 aa） Fragment：UNP RESIDUES 58-175	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BL 58–175（118 aa） Fragment：UNP RESIDUES 58-175 Chain L 58–175（118 aa） Fragment：UNP RESIDUES 58-175	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain L 1–175（175 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain L 1–175（175 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain L 55–175（121 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS4_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–118； UniProt 58–175

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

OrganismNot specified

UniProt P28331

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain M； UniProt 30–716	Fragment：UNP RESIDUES 30-716	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain M 30–716（687 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain M 30–716（687 aa） Fragment：UNP RESIDUES 30-716	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BM 30–716（687 aa） Fragment：UNP RESIDUES 30-716 Chain M 30–716（687 aa） Fragment：UNP RESIDUES 30-716	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain M 1–727（727 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain M 1–727（727 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain M 30–716（687 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–687； UniProt 30–716

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt Q9UI09

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain N； UniProt 2–144	Not recorded	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain N 2–144（143 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain N 2–144（143 aa） Fragment：UNP RESIDUES 2-144	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BN 2–144（143 aa） Fragment：UNP RESIDUES 2-144 Chain N 2–144（143 aa） Fragment：UNP RESIDUES 2-144	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain N 1–145（145 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain N 1–145（145 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain N 1–144（144 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUAC_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–143； UniProt 2–144

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

OrganismNot specified

UniProt P19404

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain O； UniProt 36–247	Fragment：UNP RESIDUES 36-247	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain O 36–247（212 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain O 36–247（212 aa） Fragment：UNP RESIDUES 36-247	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BO 36–247（212 aa） Fragment：UNP RESIDUES 36-247 Chain O 36–247（212 aa） Fragment：UNP RESIDUES 36-247	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain O 1–249（249 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain O 1–249（249 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain O 36–247（212 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUV2_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–212； UniProt 36–247

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

OrganismNot specified

UniProt O75489

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain P； UniProt 43–250	Fragment：UNP RESIDUES 43-250	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain P 43–250（208 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain P 43–250（208 aa） Fragment：UNP RESIDUES 43-250	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BP 43–250（208 aa） Fragment：UNP RESIDUES 43-250 Chain P 43–250（208 aa） Fragment：UNP RESIDUES 43-250	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain P 1–264（264 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain P 1–264（264 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain P 43–250（208 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS3_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain P； PDBConstruct 1–208； UniProt 43–250

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

UniProt O75306

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain Q； UniProt 79–463	Fragment：UNP RESIDUES 79-463	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTC Cryo-EM structure of human respiratory complex I transmembrane arm Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain Q 34–79（46 aa） Fragment：UNP RESIDUES 34-79	Not recorded	PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain Q 34–463（430 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain Q 34–463（430 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BQ 34–463（430 aa） Chain Q 34–463（430 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain Q 1–463（463 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain Q 1–463（463 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain Q 34–463（430 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 1–385； UniProt 79–463

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

OrganismNot specified

UniProt O75380

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain T； UniProt 29–123	Not recorded	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 29–123（95 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain T 29–123（95 aa） Fragment：UNP RESIDUES 29-123	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BT 29–123（95 aa） Fragment：UNP RESIDUES 29-123 Chain T 29–123（95 aa） Fragment：UNP RESIDUES 29-123	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–124（124 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–124（124 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 29–124（96 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUS6_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–95； UniProt 29–123

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

OrganismNot specified

UniProt Q9P0J0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 18 PDB declaration: octadecameric（18） Consistent with protein copy count	Chain W； UniProt 7–28	Fragment：UNP RESIDUES 7-28	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 1 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 5XTB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XTC Cryo-EM structure of human respiratory complex I transmembrane arm Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain W 29–144（116 aa） Fragment：UNP RESIDUES 29-144	Not recorded	PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTD Cryo-EM structure of human respiratory complex I Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain W 7–144（138 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 9 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 CDL CARDIOLIPIN × 5 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
5XTH Cryo-EM structure of human respiratory supercomplex I1III2IV1 Deposited 2017-06-19	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 80 PDB declaration: 80-meric	Chain W 7–144（138 aa） Fragment：UNP RESIDUES 7-144	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 12 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 4 CDL CARDIOLIPIN × 14 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 10 CU COPPER (II) ION × 3 MG MAGNESIUM ION × 1 HEA HEME-A × 2 ZN ZINC ION × 1 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
5XTI Cryo-EM architecture of human respiratory chain megacomplex-I2III2IV2 Deposited 2017-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 138 PDB declaration: 138-meric	Chain BW 7–144（138 aa） Fragment：UNP RESIDUES 7-144 Chain W 7–144（138 aa） Fragment：UNP RESIDUES 7-144	Not recorded	SF4 IRON/SULFUR CLUSTER × 12 FMN FLAVIN MONONUCLEOTIDE × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 21 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 4 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 6 CDL CARDIOLIPIN × 19 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 14 CU COPPER (II) ION × 6 MG MAGNESIUM ION × 2 HEA HEME-A × 4 ZN ZINC ION × 2 HEC HEME C × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 17.40 Å
9CWT Human kidney respiratory complex I Deposited 2024-07-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain W 1–144（144 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
9I4I High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain W 1–144（144 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 CDL CARDIOLIPIN × 6 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9TI4 High resolution Cryo-EM structure of human complex I in mitochondria Deposited 2025-12-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain W 5–144（140 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 7 8Q1 S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 PLX (9R,11S)-9-({[(1S)-1-HYDROXYHEXADECYL]OXY}METHYL)-2,2-DIMETHYL-5,7,10-TRIOXA-2LAMBDA~5~-AZA-6LAMBDA~5~-PHOSPHAOCTACOSANE-6,6,11-TRIOL × 7 ZN ZINC ION × 1 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；25 mM HEPES-KOH pH=7.5, 50 mM KCl, 20 mM Mg(OAc)2, 0.01% (v/v) Lauryl Maltose Neopentyl Glycol (LMNG), 0.001 % cardiolipin, 0.001 % glycol-diosgenin (GDN, Sigma-Aldrich), 0.1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDUAD_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain W； PDBConstruct 1–22； UniProt 7–28

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5xtb
Deposition date deposition_date	2017-06-18
Structure title title	Cryo-EM structure of human respiratory complex I matrix arm
Keywords keywords	Respiratory, OXIDOREDUCTASE-ELECTRON TRANSPORT complex; OXIDOREDUCTASE/ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	49.09 Å
Radius of gyration Rg (electron density) rg_electron	49.18 Å
Forward intensity I(0) i0	2298560000.00
Molecular weight molecular_weight	399190.0 kDa
Excluded volume excluded_volume	498880 Å³
Envelope volume envelope_volume	652240 Å³
Hydration-shell volume shell_volume	106440 Å³
Envelope diameter envelope_diameter	171.9 Å
Shell Rg shell_rg	55.40 Å
Envelope Rg envelope_rg	49.26 Å
Shape Rg shape_rg	49.25 Å
Total Rg total_rg	49.13 Å
Total atoms total_atoms	27962
Residues n_residues	3491
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	162.8 Å
Rg (real space) rg_real	48.98 Å
Rg uncertainty (real space) rg_real_error	1.06 Å
I(0) (real space) i0_real	2.2990e+09
I(0) uncertainty (real space) i0_real_error	4.0190e+07
Rg (reciprocal space) rg_reciprocal	49.09 Å
I(0) (reciprocal space) i0_reciprocal	2299000000.0000
Solution quality estimate total_estimate	0.8753
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	61.0 Å
Skewness Skewness skewness	0.303
Kurtosis Kurtosis kurtosis	-0.341
Angular range angular_range	— – 0.1600 Å⁻¹
Current regularization parameter α current_alpha	0.0003
Highest regularization parameter α highest_alpha	526400000.0000
Real-space data points n_real_points	33
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.868; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.772

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	47323.9 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	27962

PKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQH

Entity 2 Entity 2 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
Molecular weight formula_weight	20314.0 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 3 Entity 3 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Molecular weight formula_weight	17887.9 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

Entity 4 Entity 4 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Molecular weight formula_weight	13758.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

FVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 5 Entity 5 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	9535.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

LGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLS

Entity 6 Entity 6 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	9845.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

PPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 7 Entity 7 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Molecular weight formula_weight	13119.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

LKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Entity 8 Entity 8 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
Molecular weight formula_weight	12282.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

ATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Molecular weight formula_weight	38387.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

LMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVN

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
Molecular weight formula_weight	3900.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

LQHHDYSTYTFLDLNLELSKFRMPQPSSGRESP

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	13721.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

KLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 12 Entity 12 polymer

Description description	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Molecular weight formula_weight	75471.5 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

NLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTE

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	16880.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

ELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPY

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Molecular weight formula_weight	23430.9 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

GALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQA

Entity 15 Entity 15 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Molecular weight formula_weight	24432.7 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

TRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPE

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	43987.6 kDa
EC 编号 ec_number	1.6.5.3,1.6.99.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

NITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Molecular weight formula_weight	10578.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHH

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	2561.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

KQDMPPPGGYGPIDYKRNLPRR

Entity 19 Entity 19 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 20 Entity 20 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] dodecanethioate
Molecular weight formula_weight	540.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 23 Entity 23 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▼

7. Fold Classification (SCOP + CATH) 7 domains

CATH v4.4 (7 domains)

Domain ID domain_id	5xtbA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11540 — NADH-ubiquinone oxidoreductase 51kDa subunit

Domain ID domain_id	5xtbA03
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	600 —

Domain ID domain_id	5xtbA04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	230 — NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain

Domain ID domain_id	5xtbB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3270 —

Domain ID domain_id	5xtbC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	12280 —

Domain ID domain_id	5xtbF00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	5xtbQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	167761

fit	/app/data/saxs_computation/xt/5xtb/5xtb.fit
pddf	/app/data/pr_computation/xt/5xtb/5xtb.pr.out
profile	/app/data/saxs_computation/xt/5xtb/5xtb.dat

Cryo-EM structure of human respiratory complex I matrix arm

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Acyl carrier protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer