9cwt

Human kidney respiratory complex I

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–464； UniProt 1–464

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

OrganismNot specified

UniProt O00217

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–210； UniProt 1–210

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

OrganismNot specified

UniProt O75251

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–213； UniProt 1–213

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

OrganismNot specified

UniProt P56556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA6_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–128； UniProt 1–128

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt O43678

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA2_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–99； UniProt 1–99

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt O14561

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–156； UniProt 1–156 Author chain X； PDBConstruct 1–156； UniProt 1–156

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

OrganismNot specified

UniProt Q16718

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA5_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–116； UniProt 1–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

OrganismNot specified

UniProt O95182

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–113； UniProt 1–113

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

OrganismNot specified

UniProt Q16795

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–377； UniProt 1–377

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

OrganismNot specified

UniProt P56181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV3_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–108； UniProt 1–108

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt O43181

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS4_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–175； UniProt 1–175

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

OrganismNot specified

UniProt P28331

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–727； UniProt 1–727

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt Q9UI09

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAC_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–145； UniProt 1–145

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

OrganismNot specified

UniProt P19404

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV2_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–249； UniProt 1–249

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

OrganismNot specified

UniProt O75489

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS3_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain P； PDBConstruct 1–264； UniProt 1–264

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

UniProt O75306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS2_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain Q； PDBConstruct 1–463； UniProt 1–463

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1

OrganismNot specified

UniProt O15239

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA1_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–70； UniProt 1–70

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

OrganismNot specified

UniProt O75380

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS6_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain T； PDBConstruct 1–124； UniProt 1–124

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3

OrganismNot specified

UniProt O95167

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA3_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–84； UniProt 1–84

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

OrganismNot specified

UniProt Q86Y39

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAB_HUMAN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–141； UniProt 1–141

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

OrganismNot specified

UniProt Q9P0J0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAD_HUMAN
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–144； UniProt 1–144

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

OrganismNot specified

UniProt O95178

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB2_HUMAN
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain Y； PDBConstruct 1–105； UniProt 1–105

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3

OrganismNot specified

UniProt O43676

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB3_HUMAN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Z； PDBConstruct 1–98； UniProt 1–98

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

OrganismNot specified

UniProt O43674

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB5_HUMAN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain a； PDBConstruct 1–189； UniProt 1–189

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

OrganismNot specified

UniProt O95139

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB6_HUMAN
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain b； PDBConstruct 1–128； UniProt 1–128

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt O95169

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB8_HUMAN
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain c； PDBConstruct 1–186； UniProt 1–186

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10

OrganismNot specified

UniProt O96000

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBA_HUMAN
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain d； PDBConstruct 1–172； UniProt 1–172

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

OrganismNot specified

UniProt Q9NX14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBB_HUMAN
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain e； PDBConstruct 1–153； UniProt 1–153

NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

OrganismNot specified

UniProt O43677

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC1_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain f； PDBConstruct 1–76； UniProt 1–76

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt O95298

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC2_HUMAN
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain g； PDBConstruct 1–119； UniProt 1–119

NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

OrganismNot specified

UniProt O43920

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS5_HUMAN
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain h； PDBConstruct 1–106； UniProt 1–106

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

UniProt P03897

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_HUMAN
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain j； PDBConstruct 1–115； UniProt 1–115

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt P03901

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_HUMAN
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain k； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt P03915

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_HUMAN
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain l； PDBConstruct 1–603； UniProt 1–603

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt P03923

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_HUMAN
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain m； PDBConstruct 1–174； UniProt 1–174

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

OrganismNot specified

UniProt O75438

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB1_HUMAN
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain n； PDBConstruct 1–58； UniProt 1–58

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4

OrganismNot specified

UniProt O95168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB4_HUMAN
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain o； PDBConstruct 1–129； UniProt 1–129

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

OrganismNot specified

UniProt Q9Y6M9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB9_HUMAN
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain p； PDBConstruct 1–179； UniProt 1–179

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt P03905

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_HUMAN
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain r； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt P03886

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_HUMAN
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain s； PDBConstruct 1–318； UniProt 1–318

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt P51970

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA8_HUMAN
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain u； PDBConstruct 1–172； UniProt 1–172

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

OrganismNot specified

UniProt P17568

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） Unknow peptide × 1 NADH-ubiquinone oxidoreductase chain 2 × 1 （P03891） IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB7_HUMAN
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain v； PDBConstruct 1–137； UniProt 1–137

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt P03891

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 45	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （P49821） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （O00217） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （O75251） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （P56556） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （O43678） Acyl carrier protein, mitochondrial × 2 （O14561） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q16718） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （O95182） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q16795） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （P56181） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （O43181） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （P28331） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q9UI09） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （P19404） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （O75489） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （O75306） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O15239） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （O75380） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （O95167） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （Q86Y39） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9P0J0） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （O95178） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （O43676） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （O43674） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （O95139） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （O95169） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （O96000） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （Q9NX14） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （O43677） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （O95298） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （O43920） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03897） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03901） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03915） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03923） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （O75438） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （O95168） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9Y6M9） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03905） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03886） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （P51970） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （P17568） Unknow peptide × 1 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 FE2/S2 (INORGANIC) CLUSTER × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_HUMAN
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain i； PDBConstruct 1–347； UniProt 1–347

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9cwt
Deposition date deposition_date	2024-07-30
Structure title title	Human kidney respiratory complex I
Keywords keywords	human, kidney, respiratory complex I, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9cwt__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9cwt__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9cwt__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	82.78 Å
Rg (electron density)	82.86 Å
Total Rg	82.76 Å
Atom count	60914
Residues	7624
Excluded volume	1095800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9cwt__assembly_1__model_1`	45-meric （45）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (49)

Entity 1 Entity 1 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	50886.0 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	60914

MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS

Entity 2 Entity 2 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
Molecular weight formula_weight	23734.1 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 3 Entity 3 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Molecular weight formula_weight	23595.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

Entity 4 Entity 4 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Molecular weight formula_weight	15165.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Entity 5 Entity 5 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	10937.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Entity 6 Entity 6 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	17434.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,X

MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 7 Entity 7 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Molecular weight formula_weight	13477.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Entity 8 Entity 8 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
Molecular weight formula_weight	12571.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIMSSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Molecular weight formula_weight	42575.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
Molecular weight formula_weight	11958.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPRH

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	20139.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Entity 12 Entity 12 polymer

Description description	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Molecular weight formula_weight	79557.4 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	17140.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

Entity 14 Entity 14 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Molecular weight formula_weight	27425.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 15 Entity 15 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Molecular weight formula_weight	30281.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	52613.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAHWKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Molecular weight formula_weight	8084.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Molecular weight formula_weight	13733.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Entity 19 Entity 19 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
Molecular weight formula_weight	9287.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL

Entity 20 Entity 20 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
Molecular weight formula_weight	14868.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPKV

Entity 21 Entity 21 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	16721.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

Entity 22 Entity 22 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
Molecular weight formula_weight	12072.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED

Entity 23 Entity 23 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
Molecular weight formula_weight	11425.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

Entity 24 Entity 24 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
Molecular weight formula_weight	21784.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

Entity 25 Entity 25 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
Molecular weight formula_weight	15517.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

Entity 26 Entity 26 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	21791.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI

Entity 27 Entity 27 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
Molecular weight formula_weight	20808.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Entity 28 Entity 28 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Molecular weight formula_weight	17336.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE

Entity 29 Entity 29 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
Molecular weight formula_weight	8747.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLE

Entity 30 Entity 30 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14209.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

Entity 31 Entity 31 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
Molecular weight formula_weight	12542.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Entity 32 Entity 32 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13190.0 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE

Entity 33 Entity 33 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10745.1 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC

Entity 34 Entity 34 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	67068.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRIGDIGFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVCALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGGLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSITLIATSLTSAYSTRMILLTLTGQPRFPTLTNINENNPTLLNPIKRLAAGSLFAGFLITNNISPASPFQTTIPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTISQHQISTSIITSTQKGMIKLYFLSFFFPLILTLLLIT

Entity 35 Entity 35 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	18627.0 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIILNFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGLVLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTLFVGVYIVIEIARGN

Entity 36 Entity 36 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Molecular weight formula_weight	6972.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK

Entity 37 Entity 37 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
Molecular weight formula_weight	15231.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGKLDRTFHLSY

Entity 38 Entity 38 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
Molecular weight formula_weight	21867.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM

Entity 39 Entity 39 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	51613.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS

Entity 40 Entity 40 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	35676.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT

Entity 41 Entity 41 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20139.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK

Entity 42 Entity 42 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Molecular weight formula_weight	16435.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Entity 43 Entity 43 polymer

Description description	Unknow peptide
Molecular weight formula_weight	1890.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

XXXXXXXXXXXXXXXXXXXXXX

Entity 44 Entity 44 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	38980.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL

Entity 45 Entity 45 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 46 Entity 46 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 47 Entity 47 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 48 Entity 48 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 49 Entity 49 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.44 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	16097

Human kidney respiratory complex I

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acyl carrier protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer