6fvx

26S proteasome, s5 state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–242； UniProt 10–251 Author chain a； PDBConstruct 1–242； UniProt 10–251

Proteasome subunit alpha type-2

OrganismNot specified

UniProt P23639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–246； UniProt 5–250 Author chain b； PDBConstruct 1–246； UniProt 5–250

Proteasome subunit alpha type-3

OrganismNot specified

UniProt P23638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–241； UniProt 5–245 Author chain c； PDBConstruct 1–241； UniProt 5–245

Proteasome subunit alpha type-4

OrganismNot specified

UniProt P40303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–252； UniProt 3–254 Author chain d； PDBConstruct 1–252； UniProt 3–254

Proteasome subunit alpha type-5

OrganismNot specified

UniProt P32379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–244； UniProt 7–250 Author chain e； PDBConstruct 1–244； UniProt 7–250

Proteasome subunit alpha type-6

OrganismNot specified

UniProt P40302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–232； UniProt 3–234 Author chain f； PDBConstruct 1–232； UniProt 3–234

Probable proteasome subunit alpha type-7

OrganismNot specified

UniProt P21242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–244； UniProt 5–248 Author chain g； PDBConstruct 1–244； UniProt 5–248

Proteasome subunit beta type-1

OrganismNot specified

UniProt P38624

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 1； PDBConstruct 1–196； UniProt 20–215 Author chain h； PDBConstruct 1–196； UniProt 20–215

Proteasome subunit beta type-2

OrganismNot specified

UniProt P25043

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 2； PDBConstruct 1–226； UniProt 30–255 Author chain i； PDBConstruct 1–226； UniProt 30–255

Proteasome subunit beta type-3

OrganismNot specified

UniProt P25451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 3； PDBConstruct 1–204； UniProt 2–205 Author chain j； PDBConstruct 1–204； UniProt 2–205

Proteasome subunit beta type-4

OrganismNot specified

UniProt P22141

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 4； PDBConstruct 1–195； UniProt 1–195 Author chain k； PDBConstruct 1–195； UniProt 1–195

Proteasome subunit beta type-5

OrganismNot specified

UniProt P30656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 5； PDBConstruct 1–212； UniProt 76–287 Author chain l； PDBConstruct 1–212； UniProt 76–287

Proteasome subunit beta type-6

OrganismNot specified

UniProt P23724

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 6； PDBConstruct 1–222； UniProt 20–241 Author chain m； PDBConstruct 1–222； UniProt 20–241

Proteasome subunit beta type-7

OrganismNot specified

UniProt P30657

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 7； PDBConstruct 1–232； UniProt 34–265 Author chain n； PDBConstruct 1–232； UniProt 34–265

26S proteasome regulatory subunit RPN10

OrganismNot specified

UniProt P38886

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN10_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain W； PDBConstruct 1–197； UniProt 1–197

Ubiquitin carboxyl-terminal hydrolase RPN11

OrganismNot specified

UniProt P43588

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN11_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain V； PDBConstruct 1–289； UniProt 18–306

26S proteasome regulatory subunit RPN12

OrganismNot specified

UniProt P32496

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN12_YEAST
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–266； UniProt 7–272

26S proteasome regulatory subunit RPN13

OrganismNot specified

UniProt O13563

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN13_YEAST
Isoform	O13563-2
PDB entities	18
Chains and sequence ranges	Author chain X； PDBConstruct 1–127； UniProt 5–131

26S proteasome complex subunit SEM1

OrganismNot specified

UniProt O94742

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEM1_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Y； PDBConstruct 1–89； UniProt 1–89

26S proteasome regulatory subunit RPN1

OrganismNot specified

UniProt P38764

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN1_YEAST
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Z； PDBConstruct 1–970； UniProt 1–970

26S proteasome regulatory subunit RPN2

OrganismNot specified

UniProt P32565

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN2_YEAST
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain N； PDBConstruct 1–922； UniProt 4–925

26S proteasome regulatory subunit RPN3

OrganismNot specified

UniProt P40016

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN3_YEAST
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain S； PDBConstruct 1–475； UniProt 18–492

26S proteasome regulatory subunit RPN5

OrganismNot specified

UniProt Q12250

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN5_YEAST
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain P； PDBConstruct 1–440； UniProt 1–440

26S proteasome regulatory subunit RPN6

OrganismNot specified

UniProt Q12377

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN6_YEAST
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Q； PDBConstruct 1–434； UniProt 1–434

26S proteasome regulatory subunit RPN7

OrganismNot specified

UniProt Q06103

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN7_YEAST
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain R； PDBConstruct 1–405； UniProt 20–424

26S proteasome regulatory subunit RPN8

OrganismNot specified

UniProt Q08723

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN8_YEAST
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain U； PDBConstruct 1–304； UniProt 1–304

26S proteasome regulatory subunit RPN9

OrganismNot specified

UniProt Q04062

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPN9_YEAST
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain O； PDBConstruct 1–388； UniProt 6–393

26S proteasome regulatory subunit 7 homolog

OrganismNot specified

UniProt P33299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_YEAST
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain H； PDBConstruct 1–426； UniProt 42–467

26S proteasome regulatory subunit 4 homolog

OrganismNot specified

UniProt P40327

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_YEAST
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain I； PDBConstruct 1–385； UniProt 53–437

26S proteasome regulatory subunit 6B homolog

OrganismNot specified

UniProt P33298

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_YEAST
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain K； PDBConstruct 1–394； UniProt 35–428

26S proteasome subunit RPT4

OrganismNot specified

UniProt P53549

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome regulatory subunit 6A × 1 （P33297） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS10_YEAST
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain L； PDBConstruct 1–388； UniProt 49–436

26S proteasome regulatory subunit 6A

OrganismNot specified

UniProt P33297

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 8 homolog × 1 （Q01939） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6A_YEAST
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain M； PDBConstruct 1–421； UniProt 14–434

26S proteasome regulatory subunit 8 homolog

OrganismNot specified

UniProt Q01939

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 47	Proteasome subunit alpha type-1 × 2 （P21243） Proteasome subunit alpha type-2 × 2 （P23639） Proteasome subunit alpha type-3 × 2 （P23638） Proteasome subunit alpha type-4 × 2 （P40303） Proteasome subunit alpha type-5 × 2 （P32379） Proteasome subunit alpha type-6 × 2 （P40302） Probable proteasome subunit alpha type-7 × 2 （P21242） Proteasome subunit beta type-1 × 2 （P38624） Proteasome subunit beta type-2 × 2 （P25043） Proteasome subunit beta type-3 × 2 （P25451） Proteasome subunit beta type-4 × 2 （P22141） Proteasome subunit beta type-5 × 2 （P30656） Proteasome subunit beta type-6 × 2 （P23724） Proteasome subunit beta type-7 × 2 （P30657） 26S proteasome regulatory subunit RPN10 × 1 （P38886） Ubiquitin carboxyl-terminal hydrolase RPN11 × 1 （P43588） 26S proteasome regulatory subunit RPN12 × 1 （P32496） 26S proteasome regulatory subunit RPN13 × 1 （O13563） 26S proteasome complex subunit SEM1 × 1 （O94742） 26S proteasome regulatory subunit RPN1 × 1 （P38764） 26S proteasome regulatory subunit RPN2 × 1 （P32565） 26S proteasome regulatory subunit RPN3 × 1 （P40016） 26S proteasome regulatory subunit RPN5 × 1 （Q12250） 26S proteasome regulatory subunit RPN6 × 1 （Q12377） 26S proteasome regulatory subunit RPN7 × 1 （Q06103） 26S proteasome regulatory subunit RPN8 × 1 （Q08723） 26S proteasome regulatory subunit RPN9 × 1 （Q04062） 26S proteasome regulatory subunit 7 homolog × 1 （P33299） 26S proteasome regulatory subunit 4 homolog × 1 （P40327） 26S proteasome regulatory subunit 6B homolog × 1 （P33298） 26S proteasome subunit RPT4 × 1 （P53549） 26S proteasome regulatory subunit 6A × 1 （P33297） ADENOSINE-5'-TRIPHOSPHATE × 5 MAGNESIUM ION × 6 ADENOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_YEAST
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain J； PDBConstruct 1–405； UniProt 1–405

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6fvx
Deposition date deposition_date	2018-03-05
Structure title title	26S proteasome, s5 state
Keywords keywords	26S proteasome, AAA+ ATPase, hydrolase; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6fvx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6fvx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6fvx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	93.69 Å
Rg (electron density)	94.63 Å
Total Rg	94.44 Å
Atom count	110471
Residues	14020
Excluded volume	1969900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6fvx__assembly_1__model_1`	47-meric （47）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (36)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	27200.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,A
Atom count atom_count	110471

AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQ

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	26687.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,B

YSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQEINDRLEAL

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	26749.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,C

RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGIT

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	28259.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,D

GYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQQEQDKKKKSNH

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26837.1 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,E

EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIKELKEKEAAE

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	25355.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,F

RNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Entity 7 Entity 7 polymer

Description description	Probable proteasome subunit alpha type-7
Molecular weight formula_weight	26892.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,G

GTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKEIN

Entity 8 Entity 8 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	21517.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,1

TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	24486.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,2

TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEE

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22496.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,3

SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALSGWGAVVYIIKKDEVVKRYLKMRQD

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	22218.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,4

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDF

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	23325.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,5

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	24883.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,6

QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	25832.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n,7

TQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHIERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNLLGVTYSSPTLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRDARSSRNFSLAIIDKNTGLTFKKNLQVENMKWDFAKDIKGYGTQK

Entity 15 Entity 15 polymer

Description description	26S proteasome regulatory subunit RPN10
Molecular weight formula_weight	21818.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPIILEEGSS

Entity 16 Entity 16 polymer

Description description	Ubiquitin carboxyl-terminal hydrolase RPN11
Molecular weight formula_weight	32491.0 kDa
EC 编号 ec_number	3.4.19.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

TGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK

Entity 17 Entity 17 polymer

Description description	26S proteasome regulatory subunit RPN12
Molecular weight formula_weight	31111.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

LTKSLSIAFENGDYAACEKLLPPIKIELIKNNLLIPDLSIQNDIYLNDLMITKRILEVGALASIQTFNFDSFENYFNQLKPYYFSNNHKLSESDKKSKLISLYLLNLLSQNNTTKFHSELQYLDKHIKNLEDDSLLSYPIKLDRWLMEGSYQKAWDLLQSGSQNISEFDSFTDILKSAIRDEIAKNTELSYDFLPLSNIKALLFFNNEKETEKFALERNWPIVNSKVYFNNQSKEKADYEDEMMHEEDQKTNIIEKAMDYAISIEN

Entity 18 Entity 18 polymer

Description description	26S proteasome regulatory subunit RPN13
Molecular weight formula_weight	14654.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

VIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEEEELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIKSSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKDKEIYNKMIGVLNNSS

Entity 19 Entity 19 polymer

Description description	26S proteasome complex subunit SEM1
Molecular weight formula_weight	10397.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ

Entity 20 Entity 20 polymer

Description description	26S proteasome regulatory subunit RPN1
Molecular weight formula_weight	106895.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MVDESDKKQQTIDEQSQISPEKQTPNKKDKKKEEEEQLSEEDAKLKTDLELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADVLSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSAATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQDIIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDKLIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVEPALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTGDVLLIQDLLHRLTPKNVKGEEDADEEETAEGQTNSISDFLGEQVNEPTKNEEAEIEVDEMEVDAEGEEVEVKAEITEKKNGESLEGEEIKSEEKKGKSSDKDATTDGKNDDEEEEKEAGIVDELAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDPQMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLGKGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVRVGQAVETVGQAGRPKKITGWITQSTPVLLNHGERAELETDEY

Entity 21 Entity 21 polymer

Description description	26S proteasome regulatory subunit RPN2
Molecular weight formula_weight	101894.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

TTAAPLLALLRENQDSVKTYALESINNVVDQLWSEISNELPDIEALYDDDTFSDREMAALIASKVYYNLGEYESAVKYALAAKDRFDIDEKSQFVETIVSKSIEMYVQEASKQYTKDEQFYTKDIIDPKLTSIFERMIEKCLKASELKLALGIALEGYRLDIIESALKSKLDQDSTSENVKIINYLLTLAITTVTNSKFRSSILRKSFDFLMNMPNCDYLTLNKVVVNLNDAGLALQLFKKLKEENDEGLSAQIAFDLVSSASQQLLEILVTELTAQGYDPALLNILSGLPTCDYYNTFLLNNKNIDIGLLNKSKSSLDGKFSLFHTAVSVANGFMHAGTTDNSFIKANLPWLGKAQNWAKFTATASLGVIHKGNLLEGKKVMAPYLPGSRASSRFIKGGSLYGLGLIYAGFGRDTTDYLKNIIVENSGTSGDEDVDVLLHGASLGIGLAAMGSANIEVYEALKEVLYNDSATSGEAAALGMGLCMLGTGKPEAIHDMFTYSQETQHGNITRGLAVGLALINYGRQELADDLITKMLASDESLLRYGGAFTIALAYAGTGNNSAVKRLLHVAVSDSNDDVRRAAVIALGFVLLRDYTTVPRIVQLLSKSHNAHVRCGTAFALGIACAGKGLQSAIDVLDPLTKDPVDFVRQAAMIALSMILIQQTEKLNPQVADINKNFLSVITNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENADTGTLDTKSVVGLVMFSQFWYWFPLAHFLSLSFTPTTVIGIRGSDQAIPKFQMNCYAKEDAFSYPRMYEEASGKEVEKVATAVLSTTARAKARAKKTKKEKGPNEEEKKKEHEEKEKERETNKKGIKETKENDEEFYKNKYSSKPYKVDNMTRILPQQSRYISFIKDDRFVPVRKFKGNNGVVVLRDREPKEPVALIETVRQMKD

Entity 22 Entity 22 polymer

Description description	26S proteasome regulatory subunit RPN3
Molecular weight formula_weight	55378.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

LHHSEKKYAEEDQVQELLKVLNEISKTTLTLDPRYIWRSLKDLSSLRNQELLNAETLCFTVNVLYPDSSSFKKNLLKFITSNHKSSVPGSAELRNSYPASFYSVNTEKKTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEK

Entity 23 Entity 23 polymer

Description description	26S proteasome regulatory subunit RPN5
Molecular weight formula_weight	51341.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMH

Entity 24 Entity 24 polymer

Description description	26S proteasome regulatory subunit RPN6
Molecular weight formula_weight	49839.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY

Entity 25 Entity 25 polymer

Description description	26S proteasome regulatory subunit RPN7
Molecular weight formula_weight	46307.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

RVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLT

Entity 26 Entity 26 polymer

Description description	26S proteasome regulatory subunit RPN8
Molecular weight formula_weight	34557.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQ

Entity 27 Entity 27 polymer

Description description	26S proteasome regulatory subunit RPN9
Molecular weight formula_weight	45194.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

EIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV

Entity 28 Entity 28 polymer

Description description	26S proteasome regulatory subunit 7 homolog
Molecular weight formula_weight	47318.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN

Entity 29 Entity 29 polymer

Description description	26S proteasome regulatory subunit 4 homolog
Molecular weight formula_weight	43229.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

TRCKLKLLRMERIKDHLLLEEEFVSNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL

Entity 30 Entity 30 polymer

Description description	26S proteasome regulatory subunit 6B homolog
Molecular weight formula_weight	44353.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

NNNSALSNVNSDIYFKLKKLEKEYELLTLQEDYIKDEQRHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEAYATQVKTDNTVDKFDFYK

Entity 31 Entity 31 polymer

Description description	26S proteasome subunit RPT4
Molecular weight formula_weight	43931.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

EQEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQK

Entity 32 Entity 32 polymer

Description description	26S proteasome regulatory subunit 6A
Molecular weight formula_weight	46902.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

GDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQARKSKSVSFYA

Entity 33 Entity 33 polymer

Description description	26S proteasome regulatory subunit 8 homolog
Molecular weight formula_weight	45342.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK

Entity 34 Entity 34 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 35 Entity 35 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 36 Entity 36 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	146519

26S proteasome, s5 state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer