SAXSdb — 6plh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21 receptor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 202–232	Fragment：UNP Residues 202-232	Fab 5G12 light chain × 1 Fab 5G12 heavy chain × 1 PO4 PHOSPHATE ION × 1 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；25% (w/v) polyethylene glycol 1500, 0.1 M succinate-phosphate-glycine, pH 7.0	Resolution 1.60 Å R-free 0.221

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6PLH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
3TGX IL-21:IL21R complex Deposited 2011-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 20–232（213 aa） Fragment：Interleukin 21 receptor extracellular domain	Mutation：N78Q, N85Q, N106D, N116Q	MAN alpha-D-mannopyranose × 1 NI NICKEL (II) ION × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；291.3 K；1,8-1,9 M di-Ammonium sulphate and 0.1 M Sodium acetate, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 291.3K	Resolution 2.80 Å R-free 0.273
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 3 CL CHLORIDE ION × 4 TLA L(+)-TARTARIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 CL CHLORIDE ION × 5 TLA L(+)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain C 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 1 NA SODIUM ION × 2 CL CHLORIDE ION × 2 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
4NZD Interleukin 21 receptor Deposited 2013-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 20–232（213 aa） Chain B 20–232（213 aa） Chain C 20–232（213 aa）	Not recorded	MAN alpha-D-mannopyranose × 6 NA SODIUM ION × 10 CL CHLORIDE ION × 22 TLA L(+)-TARTARIC ACID × 6 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；278 K；5 mg/ml Protein in 10 mM Hepes, 150 mM NaCl, pH7.5 Crystalized in 1M Potassium sodium tartrate tetrahydrate, 3% W/V Peg5000 and 0.1 M tris Ph 8.5. Drops were 1:1, VAPOR DIFFUSION, SITTING DROP, temperature 278K	Resolution 2.75 Å R-free 0.275
7KQ7 Crystal structure of IL21R in complex with an antibody Fab fragment Deposited 2020-11-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–233（214 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；300 K；10% PEG MME 5000 and 0.1M MES, pH 6.5	Resolution 2.20 Å R-free 0.240
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
8ENT Interleukin-21 signaling complex with IL-21R and IL-2Rg Deposited 2022-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 20–229（210 aa）	Mutation：N78Q, N85Q, N106D, N116Q	EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；295 K；0.1M Tris pH 8, 20% PEG 6000	Resolution 2.83 Å R-free 0.300
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242
9E2T Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg Deposited 2024-10-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 20–228（209 aa） Fragment：extracellular domain	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.2M Potassium thiocyanate, 0.1M Bis-Tris propane, pH 6.5, 20% w/v PEG 3350	Resolution 2.28 Å R-free 0.242

5 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IL21R_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–31； UniProt 202–232

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6plh
Deposition date deposition_date	2019-06-30
Structure title title	FAB fragment complexed with C-mannosylated tryptophan peptide
Keywords keywords	C-mannosylation, FAB-fragment, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.33 Å
Radius of gyration Rg (electron density) rg_electron	25.17 Å
Forward intensity I(0) i0	41148700.00
Molecular weight molecular_weight	48751.0 kDa
Excluded volume excluded_volume	60545 Å³
Envelope volume envelope_volume	76005 Å³
Hydration-shell volume shell_volume	25396 Å³
Envelope diameter envelope_diameter	85.1 Å
Shell Rg shell_rg	32.34 Å
Envelope Rg envelope_rg	24.71 Å
Shape Rg shape_rg	25.16 Å
Total Rg total_rg	26.01 Å
Total atoms total_atoms	3442
Residues n_residues	445
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	81.7 Å
Rg (real space) rg_real	26.31 Å
Rg uncertainty (real space) rg_real_error	0.58 Å
I(0) (real space) i0_real	4.1150e+07
I(0) uncertainty (real space) i0_real_error	5.6170e+05
Rg (reciprocal space) rg_reciprocal	26.32 Å
I(0) (reciprocal space) i0_reciprocal	41150000.0000
Solution quality estimate total_estimate	0.9110
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	28.6 Å
Skewness Skewness skewness	0.246
Kurtosis Kurtosis kurtosis	-0.623
Angular range angular_range	— – 0.3000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6783000.0000
Real-space data points n_real_points	61
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.970; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.980; Smooth: 0.949

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Fab 5G12 light chain
Molecular weight formula_weight	24119.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3866

DVVMTHTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGADFTLKISRVEAEDLGVYFCSQSTHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Entity 2 Entity 2 polymer

Description description	Fab 5G12 heavy chain
Molecular weight formula_weight	23904.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

QVHLQQPGADLVKPGASVKMSCKASGYTFTSYWITWVKLRPGQGLEWIGDIYPGSGSTNFIEKFKSKATLTVDTSSSTAYMQLRSLTSEDSAVYYCARRGHGNYEDYWGQGTTLIVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIK

Entity 3 Entity 3 polymer

Description description	Interleukin-21 receptor
Molecular weight formula_weight	4302.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

AGPMPGSSYQGTWSEWSDPVIFQTQSEELKEHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Komagataella pastoris

Entity 4 Entity 4 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	alpha-D-mannopyranose
Molecular weight formula_weight	180.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	370

▼

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d6plha1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d6plha2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d6plhb_
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

CATH v4.4 (2 domains)

Domain ID domain_id	6plhA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	6plhA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	43.232 Å
Unit-cell length b length_b	89.892 Å
Unit-cell length c length_c	59.317 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.94 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.600 Å
Low-resolution limit resolution_low	44.946 Å
R factor r_factor	0.1908
R_work r_work	0.1892
R_free r_free	0.2207

fit	/app/data/saxs_computation/pl/6plh/6plh.fit
pddf	/app/data/pr_computation/pl/6plh/6plh.pr.out
profile	/app/data/saxs_computation/pl/6plh/6plh.dat

FAB fragment complexed with C-mannosylated tryptophan peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Interleukin-21 receptor

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)