SAXSdb — 6wx8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha-3

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 64–521	Not recorded	Transcription factor SOX-2 × 1 （P48431） SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；1.2M (NH4)2SO4, 0.1M HEPES pH 6.5	Resolution 2.30 Å R-free 0.245
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 64–521	Not recorded	Transcription factor SOX-2 × 1 （P48431） SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；1.2M (NH4)2SO4, 0.1M HEPES pH 6.5	Resolution 2.30 Å R-free 0.245

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6WX8	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4UAE Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain Deposited 2014-08-08	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 68–487（420 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M Na cacodylate, pH 6.5 0.1 M NaCl 1.1 M ammonium sulfate	Resolution 2.70 Å R-free 0.239
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5TBK Crystal structure of human importin a3 bound to RCC1 Deposited 2016-09-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M sodium cacodylate buffer (pH 6.5), 0.2M Calcium acetate, 8% PEG 8000 and galactose 3%	Resolution 3.45 Å R-free 0.296
5XZX Crystal structure of importin-alpha3 bound to the nuclear localization signal of Ran-binding protein 3 Deposited 2017-07-14	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 70–485（416 aa） Fragment：UNP residues 70-485	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；PEG 8000	Resolution 3.00 Å R-free 0.281
6BVV Nipah virus W protein C-terminus in complex with Importin alpha 3 Deposited 2017-12-13	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M lithium nitrate, 20% w/v PEG3350	Resolution 2.30 Å R-free 0.222
6BVZ Importin alpha 3 in cargo free state Deposited 2017-12-14	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.2 M sodium nitrate, 0.1 M bis-tris propane pH 6.5, 25% w/v PEG3350	Resolution 2.30 Å R-free 0.269
6BW9 Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1 Deposited 2017-12-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；293 K；0.1 M sodium citrate pH 5.0, 20% w/v PEG 2000	Resolution 1.60 Å R-free 0.196
6BWA Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2 Deposited 2017-12-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.2M sodium chloride, 0.1M MES pH6.5, 10% w/v PEG 4000	Resolution 2.20 Å R-free 0.215
6BWB Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3 Deposited 2017-12-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.2M sodium chloride, 0.1M MES pH6.5, 10% w/v PEG 4000	Resolution 2.30 Å R-free 0.218
7JJL Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS Deposited 2020-07-27	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；0.7 M sodium citrate, 0.01M DTT, 0.1M sodium HEPES pH 7	Resolution 2.60 Å R-free 0.266
7LF4 Structure of importin a3 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M ammonium sulfate, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3350	Resolution 2.85 Å R-free 0.238
7LF4 Structure of importin a3 bound to the p50- and p65-NLSs Deposited 2021-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M ammonium sulfate, 0.1 M BIS-TRIS pH 6.5, 25% PEG 3350	Resolution 2.85 Å R-free 0.238
7LFC Structure of importin a3 bound to p50 NLS Deposited 2021-01-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–521（521 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2M potassium thiocyanate, 20% PEG3350, 0.1 M BIS-TRIS pH 6.5	Resolution 2.10 Å R-free 0.220
7RFY Importin alpha3 in complex with MERS ORF4B Deposited 2021-07-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；0.2 M magnesium chloride, 0.1 M Tris pH 8.0, 20% w/v PEG 6000	Resolution 2.50 Å R-free 0.267
7RG5 Importin alpha3 in complex with p50 NLS Deposited 2021-07-14	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；296 K；0.2M potassium thiocyanate and 20% PEG3350	Resolution 2.15 Å R-free 0.262
8FUB Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein NLS1 Deposited 2023-01-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M sodium HEPES,0.72M sodium citrate, 1% dithiothreitol	Resolution 2.75 Å R-free 0.281
8FZM Human importin alpha 3 in complex with Bimax2 peptide Deposited 2023-01-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M sodium HEPES, 0.78M sodium citrate, 1% Dithiothreitol	Resolution 3.00 Å R-free 0.260
8FZM Human importin alpha 3 in complex with Bimax2 peptide Deposited 2023-01-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 64–521（458 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；0.1M sodium HEPES, 0.78M sodium citrate, 1% Dithiothreitol	Resolution 3.00 Å R-free 0.260
8HKW Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal Deposited 2022-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 70–485（416 aa） Fragment：UNP residues 70-485 Chain B 70–485（416 aa） Fragment：UNP residues 70-485	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Mother liquor contained PEG3350 and lithium nitrate. Crystal was grown in the presence of a synthetic peptide (amino acid sequence: GTSFSGRKIKTAVRRRK) that corresponds to human Nup153 residues 1459-1475).	Resolution 1.90 Å R-free 0.221

16 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IMA3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–459； UniProt 64–521 Author chain C； PDBConstruct 2–459； UniProt 64–521

Transcription factor SOX-2

Homo sapiens

UniProt P48431

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 39–127	Not recorded	Importin subunit alpha-3 × 1 （O00629） SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；1.2M (NH4)2SO4, 0.1M HEPES pH 6.5	Resolution 2.30 Å R-free 0.245
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 39–127	Not recorded	Importin subunit alpha-3 × 1 （O00629） SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；1.2M (NH4)2SO4, 0.1M HEPES pH 6.5	Resolution 2.30 Å R-free 0.245

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6WX8	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1O4X TERNARY COMPLEX OF THE DNA BINDING DOMAINS OF THE OCT1 AND SOX2 TRANSCRIPTION FACTORS WITH A 19MER OLIGONUCLEOTIDE FROM THE HOXB1 REGULATORY ELEMENT Deposited 2003-07-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: tetrameric	Chain B 39–121（83 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 10 mM SODIUM PHOSPHATE	Resolution not provided
2LE4 Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2 Deposited 2011-06-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–118（80 aa） Fragment：HMG box DNA binding residues 39-118	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.7；298 K；Ionic strength (raw mmCIF value) 100 mM；Pressure AMBIENT NMR sample composition 0.7 mM [U-100% 13C; U-100% 15N] Sox2, 7 % DTT, 95% H2O, 5% D2O \| 95% H2O/5% D2O	Resolution not provided
6T7B Structure of human Sox2 transcription factor in complex with a nucleosome Deposited 2019-10-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 36–121（86 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；The sample was applied onto glow-discharged Quantifoil holey carbon grids. The grids were blotted from both sides for 5-10 seconds at 16*C in a chamber at 100% humidity and plunge-frozen into liquid ethane using a manual plunger.	Resolution 5.10 Å
6T90 OCT4-SOX2-bound nucleosome - SHL-6 Deposited 2019-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 10 PDB declaration: dodecameric	Chain L 37–118（82 aa）	Not recorded	PTD PENTANEDIAL × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.05 Å
6WX7 SOX2 bound to Importin-alpha 2 Deposited 2020-05-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 39–127（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；750mM sodium citrate (pH7), 10 mM DTT	Resolution 2.70 Å R-free 0.227
6WX9 SOX2 bound to Importin-alpha 5 Deposited 2020-05-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 39–127（89 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2M sodium/potassium phosphate, 20% (w/v) PEG3350	Resolution 2.80 Å R-free 0.251
6YOV OCT4-SOX2-bound nucleosome - SHL+6 Deposited 2020-04-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 10 PDB declaration: dodecameric	Chain L 37–118（82 aa）	Not recorded	PTD PENTANEDIAL × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.42 Å
9QPF Solution structure of Sox2 DBD Deposited 2025-03-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33–127（95 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.3；293 K；Ionic strength (raw mmCIF value) 150；Pressure AMBIENT NMR sample composition 0.25 mM [U-13C; U-15N] Sox2-DBD, 135 mM potassium chloride, 20 mM TRIS, 15 mM sodium chloride, 0.01 % v/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.25 mM [U-13C; U-15N] Sox2-DBD, 135 mM potassium chloride, 20 mM TRIS, 15 mM sodium chloride, 0.01 % v/v sodium azide, 5 % v/v pentaethylene glycol monodecyl/n-Hexanol, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
9RL4 Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6 Deposited 2025-06-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 20 PDB declaration: 22-meric	Chain W 37–118（82 aa）	Not recorded	PTD PENTANEDIAL × 16 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9RMC Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1 Deposited 2025-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 20 PDB declaration: 22-meric	Chain W 37–118（82 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9RN1 Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47 bound to ATPase lobe 2 Deposited 2025-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 20 PDB declaration: 22-meric	Chain W 37–118（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
9RN2 Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2 Deposited 2025-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 19 PDB declaration: 21-meric	Chain W 37–118（82 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SOX2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–90； UniProt 39–127 Author chain D； PDBConstruct 2–90； UniProt 39–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6wx8
Deposition date deposition_date	2020-05-10
Structure title title	SOX2 bound to Importin-alpha 3
Keywords keywords	NUCLEAR PROTEIN; NUCLEAR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	36.21 Å
Radius of gyration Rg (electron density) rg_electron	35.55 Å
Forward intensity I(0) i0	193998000.00
Molecular weight molecular_weight	112300.0 kDa
Excluded volume excluded_volume	140830 Å³
Envelope volume envelope_volume	181880 Å³
Hydration-shell volume shell_volume	43476 Å³
Envelope diameter envelope_diameter	121.9 Å
Shell Rg shell_rg	40.62 Å
Envelope Rg envelope_rg	35.70 Å
Shape Rg shape_rg	35.56 Å
Total Rg total_rg	35.87 Å
Total atoms total_atoms	7886
Residues n_residues	999
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	115.1 Å
Rg (real space) rg_real	36.19 Å
Rg uncertainty (real space) rg_real_error	0.94 Å
I(0) (real space) i0_real	1.9400e+08
I(0) uncertainty (real space) i0_real_error	3.2300e+06
Rg (reciprocal space) rg_reciprocal	36.20 Å
I(0) (reciprocal space) i0_reciprocal	194000000.0000
Solution quality estimate total_estimate	0.8915
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	49.7 Å
Skewness Skewness skewness	0.252
Kurtosis Kurtosis kurtosis	-0.497
Angular range angular_range	— – 0.2200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	66220000.0000
Real-space data points n_real_points	45
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.940; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.984; Smooth: 0.781

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Importin subunit alpha-3
Molecular weight formula_weight	50325.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	8113

SGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Transcription factor SOX-2
Molecular weight formula_weight	11045.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	227

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6wx8a_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.1 — ARM repeat
Family Family family	a.118.1.0 — automated matches

Domain ID domain_id	d6wx8b_
Class class	a — All alpha proteins
Fold Fold fold	a.21 — HMG-box
Superfamily Superfamily superfamily	a.21.1 — HMG-box
Family Family family	a.21.1.1 — HMG-box

Domain ID domain_id	d6wx8c_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.1 — ARM repeat
Family Family family	a.118.1.0 — automated matches

Domain ID domain_id	d6wx8d_
Class class	a — All alpha proteins
Fold Fold fold	a.21 — HMG-box
Superfamily Superfamily superfamily	a.21.1 — HMG-box
Family Family family	a.21.1.1 — HMG-box

▶

8. Citations (1)

▶

Unit-cell length a length_a	148.580 Å
Unit-cell length b length_b	118.990 Å
Unit-cell length c length_c	94.870 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	128.77 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	29.100 Å
R factor r_factor	0.2215
R_work r_work	0.2202
R_free r_free	0.2450

fit	/app/data/saxs_computation/wx/6wx8/6wx8.fit
pddf	/app/data/pr_computation/wx/6wx8/6wx8.pr.out
profile	/app/data/saxs_computation/wx/6wx8/6wx8.dat

SOX2 bound to Importin-alpha 3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha-3

State in the Current Structure

Other States of the Same Protein in the Database

Transcription factor SOX-2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)