SAXSdb — 7l4v

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CCAAT/enhancer-binding protein beta

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Homooligomer Protein × 2 DNA 2 PDB declaration: tetrameric（4） Consistent with all polymer counts	Chain A； UniProt 246–321 Chain B； UniProt 246–321	Not recorded	DNA Strand 1 × 1 DNA Strand 2 × 1 EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；50 mM ammonium sulfate, 50 mM BIS-TRIS pH 6.5, 30% (v/v) pentaerythritol ethoxylate (15/4 EO/OH)	Resolution 1.75 Å R-free 0.221

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7L4V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1GTW crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A promoter Deposited 2002-01-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336 Chain B 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.2 M POTASSIUM CHLORIDE, 0.1 M MAGNESIUM ACETATE, 10.0% W/V PEG 8000, 0.05 M SODIUM CACODYLATE CACODYLATE BUFFER PH 6.5, PROTEIN-DNA COMPLEX SOLUTION CONTAINS 0.01 M DTT AND 0.005 M NAN3, PROTEIN:DNA RATIO IS 1:1.2	Resolution 1.85 Å R-free 0.271
1GTW crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A promoter Deposited 2002-01-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336 Chain B 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.2 M POTASSIUM CHLORIDE, 0.1 M MAGNESIUM ACETATE, 10.0% W/V PEG 8000, 0.05 M SODIUM CACODYLATE CACODYLATE BUFFER PH 6.5, PROTEIN-DNA COMPLEX SOLUTION CONTAINS 0.01 M DTT AND 0.005 M NAN3, PROTEIN:DNA RATIO IS 1:1.2	Resolution 1.85 Å R-free 0.271
1GU4 Crystal structure of C/EBPBETA BZIP homodimer bound to a high affinity DNA fragment Deposited 2002-01-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336 Chain B 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；0.2 M POTASSIUM CHLORIDE, 0.01 M MAGNESIUM SULFATE, 10.0% V/V PEG 400, 0.05 M MES BUFFER PH 6.0, PROTEIN-DNA COMPLEX CONCENTRATION WAS 12 MG/ML AND CONTAINS 0.01 M DTT, PROTEIN:DNA RATIO WAS 1:1.2. FOR CRYOPROTECTION THE CONCENTRATION OF PEG 400 WAS ADJUSTED TO 36% V/V	Resolution 1.80 Å R-free 0.266
1GU5 Crystal structure of C/EBPBETA BZIP homodimer bound to a DNA fragment from the MIM-1 promoter Deposited 2002-01-24	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336 Chain B 259–336（78 aa） Fragment：BZIP DOMAIN, RESIDUES 259-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.08 M MAGNESIUM ACETATE, 15.0% V/V PEG 400, 0.05 M SODIUM CACODYLATE BUFFER PH 6.5, PROTEIN-DNA COMPLEX CONCENTRATION WAS 12 MG/ML WITH ADDITION OF 0.01 M DTT, PROTEIN:DNA RATIO WAS 1:1.2 FOR CRYOPROTECTION THE CONCENTRATION OF PEG 400 WAS ADJUSTED TO 36% V/V	Resolution 2.10 Å R-free 0.277
1H88 CRYSTAL STRUCTURE OF TERNARY PROTEIN-DNA COMPLEX1 Deposited 2001-01-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 259–336（78 aa） Fragment：RESIDUES 259-336 Chain B 259–336（78 aa） Fragment：RESIDUES 259-336	Not recorded	NH4 AMMONIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；297 K；0.05 M AMMONIUM ACETATE, 0.01 M MAGNESIUM CHLORIDE, 10% V/V MPD, 6% V/V GLYCEROL, 0.05 M TRIS HCL BUFFER PH 7.5 AT 24 DEGREES C	Resolution 2.80 Å R-free 0.277
1H89 CRYSTAL STRUCTURE OF TERNARY PROTEIN-DNA COMPLEX2 Deposited 2001-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 273–336（64 aa） Fragment：RESIDUES 273-336 Chain B 273–336（64 aa） Fragment：RESIDUES 273-336	Not recorded	K POTASSIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；297 K；0.1 M KCL, 0.05 MGSO4, 4% V/V MPD, 6% V/V GLYCEROL, 0.05 M NA HEPES PH 7.0 AT 24 DEGREES C	Resolution 2.45 Å R-free 0.267
1H8A CRYSTAL STRUCTURE OF TERNARY PROTEIN-DNA COMPLEX3 Deposited 2001-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 259–336（78 aa） Fragment：RESIDUES 259-336 Chain B 259–336（78 aa） Fragment：RESIDUES 259-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；297 K；0.04 M MAGNESIUM CHLORIDE, 20% V/V MPD, 0.05 M SODIUM CACODYLATE BUFFER PH 6.0 AT 24 DEGREES C	Resolution 2.23 Å R-free 0.288
1HJB CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN AND C/EBPBETA BZIP HOMODIMER BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER Deposited 2001-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain A 259–345（87 aa） Fragment：RESIDUES 259-345 Chain B 259–345（87 aa） Fragment：RESIDUES 259-345	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；297 K；5 MM MGSO4, 3% W/V PEG 4000, 1% V/V DIOXANE, 50 MM MES BUFFER, PH 5.6 AT 24 DEGREES C	Resolution 3.00 Å R-free 0.313
1HJB CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN AND C/EBPBETA BZIP HOMODIMER BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER Deposited 2001-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–DNA Heteromer；Protein × 3 PDB declaration: pentameric	Chain D 259–345（87 aa） Fragment：RESIDUES 259-345 Chain E 259–345（87 aa） Fragment：RESIDUES 259-345	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；297 K；5 MM MGSO4, 3% W/V PEG 4000, 1% V/V DIOXANE, 50 MM MES BUFFER, PH 5.6 AT 24 DEGREES C	Resolution 3.00 Å R-free 0.313
1IO4 CRYSTAL STRUCTURE OF RUNX-1/AML1/CBFALPHA RUNT DOMAIN-CBFBETA CORE DOMAIN HETERODIMER AND C/EBPBETA BZIP HOMODIMER BOUND TO A DNA FRAGMENT FROM THE CSF-1R PROMOTER Deposited 2001-01-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain A 259–336（78 aa） Fragment：BZIP DOMAIN Chain B 259–336（78 aa） Fragment：BZIP DOMAIN	Not recorded	AU GOLD ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；297 K；0.2 M potassium chloride, 0.01 M magnesium chloride, 0.01 M DTT, 4.5% V/V PEG 8000, 1% V/V glycerol, 1% V/V MPD, 0.05 M MES buffer pH 5.6, pH 5.60, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 3.00 Å R-free 0.299
2E42 Crystal structure of C/EBPbeta Bzip homodimer V285A mutant bound to A High Affinity DNA fragment Deposited 2006-12-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 259–336（78 aa） Fragment：residues 259-336 Chain B 259–336（78 aa） Fragment：residues 259-336	Mutation：V285A Mutation：V285A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；magnesium chloride, MES, PEG400, PH 6, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K	Resolution 1.80 Å R-free 0.252
2E43 Crystal structure of C/EBPbeta Bzip homodimer K269A mutant bound to A High Affinity DNA fragment Deposited 2006-12-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 259–336（78 aa） Fragment：residues 259-336 Chain B 259–336（78 aa） Fragment：residues 259-336	Mutation：K269A Mutation：K269A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；magnesium chloride, Tris-Hcl, PEG4000, PH 7.5, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K	Resolution 2.10 Å R-free 0.259
6MG1 C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide Containing Consensus Recognition Sequence-C2 Crystal Form Deposited 2018-09-12	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 246–321（76 aa） Chain B 246–321（76 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.2 M sodium chloride, 0.1 M BIS-TRIS pH 6.5, 25% (w/v) polyethylene glycol 3350	Resolution 1.75 Å R-free 0.250
6MG2 C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide Containing Consensus Recognition Sequence-C2221 Crystal Form Deposited 2018-09-12	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 246–321（76 aa） Chain B 246–321（76 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；292 K；0.1 M sodium acetate trihydrate pH 7.0, 12% (w/v) polyethylene glycol 3350	Resolution 1.93 Å R-free 0.210
6MG3 V285A Mutant of the C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide Containing Consensus Recognition Sequence Deposited 2018-09-12	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 246–321（76 aa） Chain B 246–321（76 aa）	Mutation：V285A Mutation：V285A	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；292 K；0.1 M sodium acetate trihydrate pH 7.0, 12% (w/v) polyethylene glycol 3350	Resolution 2.05 Å R-free 0.249
7UPZ Structural basis for cell type specific DNA binding of C/EBPbeta: the case of cell cycle inhibitor p15INK4b promoter Deposited 2022-04-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 257–336（80 aa） Fragment：UNP residues 257-336 Chain B 257–336（80 aa） Fragment：UNP residues 257-336	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；100 mM potassium chloride, 10 mM magnesium chloride, 50 mM MES, pH 6.0, 10% v/v PEG400, 5% v/v glycerol	Resolution 2.49 Å R-free 0.264
8K8D Crystal structure of C/EBPbeta BZIP domain bound to a high affinity DNA Deposited 2023-07-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 259–336（78 aa） Chain B 259–336（78 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.02 M Calcium chloride dihydrate,0.1 M Sodium acetate trihydrate pH 4.6 and 20% v/v 2-Propanol	Resolution 2.20 Å R-free 0.292

15 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CEBPB_HUMAN
Isoform	P17676-2
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–78； UniProt 246–321 Author chain B； PDBConstruct 3–78； UniProt 246–321

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7l4v
Deposition date deposition_date	2020-12-21
Structure title title	C-terminal bZIP domain of human C/EBPbeta Bound to DNA with Consensus Recognition with GT Mismatch
Keywords keywords	;bZIP Transciption Factor DNA Methylation CpA methylation PROTEIN-DNA COMPLEX, TRANSCRIPTION, TRANSCRIPTION-DNA complex, G-T DNA Mismatch ;; TRANSCRIPTION/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.91 Å
Radius of gyration Rg (electron density) rg_electron	27.92 Å
Forward intensity I(0) i0	18137300.00
Molecular weight molecular_weight	25921.0 kDa
Excluded volume excluded_volume	29622 Å³
Envelope volume envelope_volume	43266 Å³
Hydration-shell volume shell_volume	15351 Å³
Envelope diameter envelope_diameter	103.4 Å
Shell Rg shell_rg	29.43 Å
Envelope Rg envelope_rg	28.96 Å
Shape Rg shape_rg	28.01 Å
Total Rg total_rg	27.88 Å
Total atoms total_atoms	1781
Residues n_residues	167
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	99.7 Å
Rg (real space) rg_real	26.55 Å
Rg uncertainty (real space) rg_real_error	1.22 Å
I(0) (real space) i0_real	1.8140e+07
I(0) uncertainty (real space) i0_real_error	2.8250e+05
Rg (reciprocal space) rg_reciprocal	26.35 Å
I(0) (reciprocal space) i0_reciprocal	18130000.0000
Solution quality estimate total_estimate	0.6803
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	19.6 Å
Skewness Skewness skewness	0.768
Kurtosis Kurtosis kurtosis	-0.116
Angular range angular_range	— – 0.3050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1109000.0000
Real-space data points n_real_points	62
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.267; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.056; Smooth: 0.982

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	CCAAT/enhancer-binding protein beta
Molecular weight formula_weight	9325.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1996

HMKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DNA Strand 1
Molecular weight formula_weight	4961.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

AGGATTGTGCAATATA

Entity 3 Entity 3 polymer

Description description	DNA Strand 2
Molecular weight formula_weight	4848.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

ATATTGCGCAATCCTT

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	206

▶

8. Citations (1)

▶

Unit-cell length a length_a	101.452 Å
Unit-cell length b length_b	113.144 Å
Unit-cell length c length_c	75.740 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	37.770 Å
R factor r_factor	0.2004
R_work r_work	0.1994
R_free r_free	0.2213

fit	/app/data/saxs_computation/l4/7l4v/7l4v.fit
pddf	/app/data/pr_computation/l4/7l4v/7l4v.pr.out
profile	/app/data/saxs_computation/l4/7l4v/7l4v.dat

C-terminal bZIP domain of human C/EBPbeta Bound to DNA with Consensus Recognition with GT Mismatch

1. Protein Identity and Related Structures Protein Identity & Related Structures

CCAAT/enhancer-binding protein beta

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)