7peq

Model of the outer rings of the human nuclear pore complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear pore complex protein Nup133

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU133_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AC； PDBConstruct 1–1156； UniProt 1–1156 Author chain BC； PDBConstruct 1–1156； UniProt 1–1156 Author chain CC； PDBConstruct 1–1156； UniProt 1–1156 Author chain DC； PDBConstruct 1–1156； UniProt 1–1156

Nuclear pore complex protein Nup107

OrganismNot specified

UniProt P57740

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU107_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AD； PDBConstruct 1–925； UniProt 1–925 Author chain BD； PDBConstruct 1–925； UniProt 1–925 Author chain CD； PDBConstruct 1–925； UniProt 1–925 Author chain DD； PDBConstruct 1–925； UniProt 1–925

Nuclear pore complex protein Nup96

OrganismNot specified

UniProt P52948

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUP98_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AE； PDBConstruct 1–937； UniProt 881–1817 Author chain BE； PDBConstruct 1–937； UniProt 881–1817 Author chain CE； PDBConstruct 1–937； UniProt 881–1817 Author chain DE； PDBConstruct 1–937； UniProt 881–1817

Protein SEC13 homolog

OrganismNot specified

UniProt P55735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEC13_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AF； PDBConstruct 1–322； UniProt 1–322 Author chain BF； PDBConstruct 1–322； UniProt 1–322 Author chain CF； PDBConstruct 1–322； UniProt 1–322 Author chain DF； PDBConstruct 1–322； UniProt 1–322

Nucleoporin SEH1

OrganismNot specified

UniProt Q96EE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEH1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AG； PDBConstruct 1–360； UniProt 1–360 Author chain BG； PDBConstruct 1–360； UniProt 1–360 Author chain CG； PDBConstruct 1–360； UniProt 1–360 Author chain DG； PDBConstruct 1–360； UniProt 1–360

Nuclear pore complex protein Nup85

OrganismNot specified

UniProt Q9BW27

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUP85_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AH； PDBConstruct 1–656； UniProt 1–656 Author chain BH； PDBConstruct 1–656； UniProt 1–656 Author chain CH； PDBConstruct 1–656； UniProt 1–656 Author chain DH； PDBConstruct 1–656； UniProt 1–656

Nucleoporin Nup43

OrganismNot specified

UniProt Q8NFH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nuclear pore complex protein Nup160 × 32 （Q12769） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUP43_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AI； PDBConstruct 1–380； UniProt 1–380 Author chain BI； PDBConstruct 1–380； UniProt 1–380 Author chain CI； PDBConstruct 1–380； UniProt 1–380 Author chain DI； PDBConstruct 1–380； UniProt 1–380

Nuclear pore complex protein Nup160

OrganismNot specified

UniProt Q12769

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nucleoporin Nup37 × 32 （Q8NFH4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU160_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–1436； UniProt 1–1436 Author chain BJ； PDBConstruct 1–1436； UniProt 1–1436 Author chain CJ； PDBConstruct 1–1436； UniProt 1–1436 Author chain DJ； PDBConstruct 1–1436； UniProt 1–1436

Nucleoporin Nup37

OrganismNot specified

UniProt Q8NFH4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 288	Nuclear pore complex protein Nup133 × 32 （Q8WUM0） Nuclear pore complex protein Nup107 × 32 （P57740） Nuclear pore complex protein Nup96 × 32 （P52948） Protein SEC13 homolog × 32 （P55735） Nucleoporin SEH1 × 32 （Q96EE3） Nuclear pore complex protein Nup85 × 32 （Q9BW27） Nucleoporin Nup43 × 32 （Q8NFH3） Nuclear pore complex protein Nup160 × 32 （Q12769）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUP37_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AK； PDBConstruct 1–326； UniProt 1–326 Author chain BK； PDBConstruct 1–326； UniProt 1–326 Author chain CK； PDBConstruct 1–326； UniProt 1–326 Author chain DK； PDBConstruct 1–326； UniProt 1–326

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7peq
Deposition date deposition_date	2021-08-11
Structure title title	Model of the outer rings of the human nuclear pore complex
Keywords keywords	Nuclear Pore Complex, NPC, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7peq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7peq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7peq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	569.90 Å
Total Rg	569.90 Å
Atom count	729632
Residues	147232
Excluded volume	11775000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7peq__assembly_1__model_1`	288-meric （288）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Nuclear pore complex protein Nup133
Molecular weight formula_weight	129108.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,BC,CC,DC
Atom count atom_count	91352

MFPAAPSPRTPGTGSRRGPLAGLGPGSTPRTASRKGLPLGSAVSSPVLFSPVGRRSSLSSRGTPTRMFPHHSITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATREGSIRYWPSLAGEDTYTEAFVDSGGDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILPQGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSSEKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHSADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYLYNESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSRENVSILAEDLEGSLASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDLGHAQMVVDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASDPRWAESVPEEAPGFSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEKLSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEHEEQVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSGPGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGKRGKLLSQPISQHGQLANFLQAHEHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQEKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFKKALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI

Entity 2 Entity 2 polymer

Description description	Nuclear pore complex protein Nup107
Molecular weight formula_weight	106505.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD,BD,CD,DD

MDRSGFGEISSPVIREAEVTRTARKQSAQKRVLLQASQDENFGNTTPRNQVIPRTPSSFRQPFTPTSRSLLRQPDISCILGTGGKSPRLTQSSGFFGNLSMVTNLDDSNWAAAFSSQRSGLFTNTEPHSITEDVTISAVMLREDDPGEAASMSMFSDFLQSFLKHSSSTVFDLVEEYENICGSQVNILSKIVSRATPGLQKFSKTASMLWLLQQEMVTWRLLASLYRDRIQSALEEESVFAVTAVNASEKTVVEALFQRDSLVRQSQLVVDWLESIAKDEIGEFSDNIEFYAKSVYWENTLHTLKQRQLTSYVGSVRPLVTELDPDAPIRQKMPLDDLDREDEVRLLKYLFTLIRAGMTEEAQRLCKRCGQAWRAATLEGWKLYHDPNVNGGTELEPVEGNPYRRIWKISCWRMAEDELFNRYERAIYAALSGNLKQLLPVCDTWEDTVWAYFRVMVDSLVEQEIQTSVATLDETEELPREYLGANWTLEKVFEELQATDKKRVLEENQEHYHIVQKFLILGDIDGLMDEFSKWLSKSRNNLPGHLLRFMTHLILFFRTLGLQTKEEVSIEVLKTYIQLLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEADLDVATITKTVVENIRKKDNGEFSHHDLAPALDTGTTEEDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFGIWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCFLLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKLLQKLRESSLMLLDQGLDPLGYEIQL

Entity 3 Entity 3 polymer

Description description	Nuclear pore complex protein Nup96
Molecular weight formula_weight	106039.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE,BE,CE,DE

SKYGLQDSDEEEEEHPSKTSTKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEKLSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYSDRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL

Entity 4 Entity 4 polymer

Description description	Protein SEC13 homolog
Molecular weight formula_weight	35578.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF,BF,CF,DF

MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ

Entity 5 Entity 5 polymer

Description description	Nucleoporin SEH1
Molecular weight formula_weight	39700.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG,BG,CG,DG

MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS

Entity 6 Entity 6 polymer

Description description	Nuclear pore complex protein Nup85
Molecular weight formula_weight	75105.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH,BH,CH,DH

MEELDGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKDVDVYSQILRKLFNESHGIFLGLQRIDEELTGKSRKSQLVRVSKNYRSVIRACMEEMHQVAIAAKDPANGRQFSSQVSILSAMELIWNLCEILFIEVAPAGPLLLHLLDWVRLHVCEVDSLSADVLGSENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHLESLLKIMLGDEAALLEQKELLSNWYHFLVTRLLYSNPTVKPIDLHYYAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLYFGSNMREFLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWSIRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKYREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTDALPLLEQKQVIFSAEQTYELMRCLEDLTSRRPVHGESDTEQLQDDDIETTKVEMLRLSLARNLARAIIREGSLEGS

Entity 7 Entity 7 polymer

Description description	Nucleoporin Nup43
Molecular weight formula_weight	42195.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI,BI,CI,DI

MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS

Entity 8 Entity 8 polymer

Description description	Nuclear pore complex protein Nup160
Molecular weight formula_weight	162280.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ,BJ,CJ,DJ

MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVDSQMQSIFTDIGKVDFTDPCNYQLIPAVPGISPNSTASTAWLSSDGEALFALPCASGGIFVLKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQSPSDRPLSLAVHCVEHDAFIFALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSPTMGLYLGIYMHAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVKYINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFCRGTERNLDLSWSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQEALSHPLALHLNPHTNMVCLLKKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIARDVICLIKCLRLIEESVTVDMSVIMEMSCYNLQSPEKAAEQILEDMITIDVENVMEDICSKLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIRMNLTQLYGSNTAGYIVCRGVHKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLLLSYYLIKWGSECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLFSQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCRFMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRLQYYDKVLRLLDVIGLPELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEKQGNCYLAALNCLRLIRPEYAWIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLARIRLTLAQHDPSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAAQAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENSANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL

Entity 9 Entity 9 polymer

Description description	Nucleoporin Nup37
Molecular weight formula_weight	36748.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,BK,CK,DK

MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEGIQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDLLAQQAILSLESEQVPLMSAHWCLKNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV

▶

Resolution resolution	35.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	1252

Model of the outer rings of the human nuclear pore complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear pore complex protein Nup133

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear pore complex protein Nup107

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear pore complex protein Nup96

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein SEC13 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin SEH1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear pore complex protein Nup85

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin Nup43

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear pore complex protein Nup160

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoporin Nup37

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7peq__assembly_1__model_1

7peq__assembly_1__model_1 | I(q)

7peq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment