SAXSdb — 7s59

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P974

Amblyomma cajennense

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7 × 1 （P80075,P80098） SULFATE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7 × 1 （P80075,P80098） SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EV974_AMBCJ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–85； UniProt 30–114 Author chain 3； PDBConstruct 1–85； UniProt 30–114

chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7

Homo sapiens

UniProt P80075

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Evasin P974 × 1 （A0A023FDY8） SULFATE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Evasin P974 × 1 （A0A023FDY8） SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCL8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–15； UniProt 24–38 Author chain 4； PDBConstruct 1–15； UniProt 24–38

chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7

Homo sapiens

UniProt P80098

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Evasin P974 × 1 （A0A023FDY8） SULFATE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Evasin P974 × 1 （A0A023FDY8） SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCL7_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 16–76； UniProt 39–99 Author chain 4； PDBConstruct 16–76； UniProt 39–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s59
Deposition date deposition_date	2021-09-10
Structure title title	Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human chemokines CCL7 and CCL8
Keywords keywords	Inflammation, Evasin, Chemokine binder, Evasin-chemokine complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7s59__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7s59__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7s59__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.72 Å
Rg (electron density)	15.90 Å
Total Rg	16.76 Å
Atom count	1137
Residues	151
Excluded volume	19995 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7s59__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7s59__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Evasin P974
Molecular weight formula_weight	9702.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,3
Atom count atom_count	2302

DYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLTDGTACYVVERKVWDRMTPMLWYECPLGECKNGVCEDLRKKEDCRKGN

Source Source

Source organism organism	Amblyomma cajennense
Common name common_name	Cayenne tick, Acarus cajennensis
NCBI taxonomy ID ncbi_taxonomy_id	34607
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7
Molecular weight formula_weight	8906.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,2

QPDSVSIPITCCFNVINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	9

▶

Unit-cell length a length_a	126.240 Å
Unit-cell length b length_b	62.718 Å
Unit-cell length c length_c	53.966 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.93 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	2.390 Å
Low-resolution limit resolution_low	42.380 Å
R factor r_factor	0.2390
R_work r_work	0.2374
R_free r_free	0.2679

Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human chemokines CCL7 and CCL8

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P974

State in the Current Structure

Other States of the Same Protein in the Database

chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7

State in the Current Structure

Other States of the Same Protein in the Database

chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s59__assembly_1__model_1

7s59__assembly_1__model_1 | I(q)

7s59__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of the tick evasin EVA-P974 complexed to a chimera made of human chemokines CCL7 and CCL8

1. Protein Identity and Related Structures Protein Identity & Related Structures

Evasin P974

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

chimera protein of C-C motif chemokine 7 and C-C motif chemokine 8,C-C motif chemokine 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s59__assembly_1__model_1

7s59__assembly_1__model_1 | I(q)

7s59__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)