SAXSdb — 7tnq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Microtubule associated protein SPM1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 100	Tubulin alpha chain × 26 （P10873） Tubulin beta chain × 26 （A0A125YWG5） PDI family protein × 20 （A0A125YMM3） PDI family protein × 4 （A0A125YFI4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	S8F1Y1_TOXGM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–351； UniProt 1–351 Author chain 1； PDBConstruct 1–351； UniProt 1–351 Author chain 10； PDBConstruct 1–351； UniProt 1–351 Author chain 11； PDBConstruct 1–351； UniProt 1–351 Author chain 12； PDBConstruct 1–351； UniProt 1–351 Author chain 13； PDBConstruct 1–351； UniProt 1–351 Author chain 14； PDBConstruct 1–351； UniProt 1–351 Author chain 15； PDBConstruct 1–351； UniProt 1–351 Author chain 16； PDBConstruct 1–351； UniProt 1–351 Author chain 17； PDBConstruct 1–351； UniProt 1–351 Author chain 18； PDBConstruct 1–351； UniProt 1–351 Author chain 19； PDBConstruct 1–351； UniProt 1–351 Author chain 2； PDBConstruct 1–351； UniProt 1–351 Author chain 20； PDBConstruct 1–351； UniProt 1–351 Author chain 21； PDBConstruct 1–351； UniProt 1–351 Author chain 22； PDBConstruct 1–351； UniProt 1–351 Author chain 23； PDBConstruct 1–351； UniProt 1–351 Author chain 3； PDBConstruct 1–351； UniProt 1–351 Author chain 4； PDBConstruct 1–351； UniProt 1–351 Author chain 5； PDBConstruct 1–351； UniProt 1–351 Author chain 6； PDBConstruct 1–351； UniProt 1–351 Author chain 7； PDBConstruct 1–351； UniProt 1–351 Author chain 8； PDBConstruct 1–351； UniProt 1–351 Author chain 9； PDBConstruct 1–351； UniProt 1–351

Tubulin alpha chain

OrganismNot specified

UniProt P10873

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 100	Microtubule associated protein SPM1 × 24 （S8F1Y1） Tubulin beta chain × 26 （A0A125YWG5） PDI family protein × 20 （A0A125YMM3） PDI family protein × 4 （A0A125YFI4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA_TOXGO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A0； PDBConstruct 1–453； UniProt 1–453 Author chain A2； PDBConstruct 1–453； UniProt 1–453 Author chain A4； PDBConstruct 1–453； UniProt 1–453 Author chain A6； PDBConstruct 1–453； UniProt 1–453 Author chain A8； PDBConstruct 1–453； UniProt 1–453 Author chain B0； PDBConstruct 1–453； UniProt 1–453 Author chain B2； PDBConstruct 1–453； UniProt 1–453 Author chain B4； PDBConstruct 1–453； UniProt 1–453 Author chain B6； PDBConstruct 1–453； UniProt 1–453 Author chain B8； PDBConstruct 1–453； UniProt 1–453 Author chain C0； PDBConstruct 1–453； UniProt 1–453 Author chain C2； PDBConstruct 1–453； UniProt 1–453 Author chain C4； PDBConstruct 1–453； UniProt 1–453 Author chain C6； PDBConstruct 1–453； UniProt 1–453 Author chain C8； PDBConstruct 1–453； UniProt 1–453 Author chain D0； PDBConstruct 1–453； UniProt 1–453 Author chain D2； PDBConstruct 1–453； UniProt 1–453 Author chain D4； PDBConstruct 1–453； UniProt 1–453 Author chain D6； PDBConstruct 1–453； UniProt 1–453 Author chain D8； PDBConstruct 1–453； UniProt 1–453 Author chain E0； PDBConstruct 1–453； UniProt 1–453 Author chain E2； PDBConstruct 1–453； UniProt 1–453 Author chain E4； PDBConstruct 1–453； UniProt 1–453 Author chain E6； PDBConstruct 1–453； UniProt 1–453 Author chain E8； PDBConstruct 1–453； UniProt 1–453 Author chain F0； PDBConstruct 1–453； UniProt 1–453

Tubulin beta chain

OrganismNot specified

UniProt A0A125YWG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 100	Microtubule associated protein SPM1 × 24 （S8F1Y1） Tubulin alpha chain × 26 （P10873） PDI family protein × 20 （A0A125YMM3） PDI family protein × 4 （A0A125YFI4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A125YWG5_TOXGM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A1； PDBConstruct 1–449； UniProt 1–449 Author chain A3； PDBConstruct 1–449； UniProt 1–449 Author chain A5； PDBConstruct 1–449； UniProt 1–449 Author chain A7； PDBConstruct 1–449； UniProt 1–449 Author chain A9； PDBConstruct 1–449； UniProt 1–449 Author chain B1； PDBConstruct 1–449； UniProt 1–449 Author chain B3； PDBConstruct 1–449； UniProt 1–449 Author chain B5； PDBConstruct 1–449； UniProt 1–449 Author chain B7； PDBConstruct 1–449； UniProt 1–449 Author chain B9； PDBConstruct 1–449； UniProt 1–449 Author chain C1； PDBConstruct 1–449； UniProt 1–449 Author chain C3； PDBConstruct 1–449； UniProt 1–449 Author chain C5； PDBConstruct 1–449； UniProt 1–449 Author chain C7； PDBConstruct 1–449； UniProt 1–449 Author chain C9； PDBConstruct 1–449； UniProt 1–449 Author chain D1； PDBConstruct 1–449； UniProt 1–449 Author chain D3； PDBConstruct 1–449； UniProt 1–449 Author chain D5； PDBConstruct 1–449； UniProt 1–449 Author chain D7； PDBConstruct 1–449； UniProt 1–449 Author chain D9； PDBConstruct 1–449； UniProt 1–449 Author chain E1； PDBConstruct 1–449； UniProt 1–449 Author chain E3； PDBConstruct 1–449； UniProt 1–449 Author chain E5； PDBConstruct 1–449； UniProt 1–449 Author chain E7； PDBConstruct 1–449； UniProt 1–449 Author chain E9； PDBConstruct 1–449； UniProt 1–449 Author chain F1； PDBConstruct 1–449； UniProt 1–449

PDI family protein

OrganismNot specified

UniProt A0A125YMM3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 100	Microtubule associated protein SPM1 × 24 （S8F1Y1） Tubulin alpha chain × 26 （P10873） Tubulin beta chain × 26 （A0A125YWG5） PDI family protein × 4 （A0A125YFI4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A125YMM3_TOXGM
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain a； PDBConstruct 1–220； UniProt 1–220 Author chain b； PDBConstruct 1–220； UniProt 1–220 Author chain c； PDBConstruct 1–220； UniProt 1–220 Author chain d； PDBConstruct 1–220； UniProt 1–220 Author chain e； PDBConstruct 1–220； UniProt 1–220 Author chain f； PDBConstruct 1–220； UniProt 1–220 Author chain g； PDBConstruct 1–220； UniProt 1–220 Author chain h； PDBConstruct 1–220； UniProt 1–220 Author chain i； PDBConstruct 1–220； UniProt 1–220 Author chain j； PDBConstruct 1–220； UniProt 1–220 Author chain m； PDBConstruct 1–220； UniProt 1–220 Author chain n； PDBConstruct 1–220； UniProt 1–220 Author chain o； PDBConstruct 1–220； UniProt 1–220 Author chain p； PDBConstruct 1–220； UniProt 1–220 Author chain q； PDBConstruct 1–220； UniProt 1–220 Author chain r； PDBConstruct 1–220； UniProt 1–220 Author chain s； PDBConstruct 1–220； UniProt 1–220 Author chain t； PDBConstruct 1–220； UniProt 1–220 Author chain u； PDBConstruct 1–220； UniProt 1–220 Author chain v； PDBConstruct 1–220； UniProt 1–220

PDI family protein

OrganismNot specified

UniProt A0A125YFI4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 100	Microtubule associated protein SPM1 × 24 （S8F1Y1） Tubulin alpha chain × 26 （P10873） Tubulin beta chain × 26 （A0A125YWG5） PDI family protein × 20 （A0A125YMM3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A125YFI4_TOXGM
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain k； PDBConstruct 1–189； UniProt 1–189 Author chain l； PDBConstruct 1–189； UniProt 1–189 Author chain w； PDBConstruct 1–189； UniProt 1–189 Author chain x； PDBConstruct 1–189； UniProt 1–189

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7tnq
Deposition date deposition_date	2022-01-21
Structure title title	The symmetry-released subpellicular microtubule map from detergent-extracted Toxoplasma cells
Keywords keywords	parasites, Toxoplasma gondii, cytoskeleton, microtubules, tubulin, CELL INVASION; CELL INVASION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7tnq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7tnq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7tnq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	121.50 Å
Total Rg	121.50 Å
Atom count	213168
Residues	27210
Excluded volume	3779300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7tnq__assembly_1__model_1`	100-meric （100）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Microtubule associated protein SPM1
Molecular weight formula_weight	38817.7 kDa
Source method src_method	nat
Copy count entity_count	24

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,1,10,11,12,13,14,15,16,17,18,19,2,20,21,22,23,3,4,5,6,7,8,9
Atom count atom_count	213168

MSGGNSNTPKKLPSEEGSDYGYPQKPQKYLPKSEQAEPDYSACCKGNDAYKGASHGTVQFSHPEEAQKYAGAAAGAETIQRGRERVAADRQPRAAGDVPARRLHLSDVDEAHRGQSPSRHPGYCVEELCTCGMHKCIPSRAPVPFTGSTQYRQEFVPKPLPPPTQVSQVTLPPSLPFEAESSYRTEFVAKPLPPPAKFSEVKLPPTLPFHGESAYRTDYVPKPLPEVAKPVEVKLPPTLPFNAQSCYRSEYVAKPLPPPVQTAEVKLPPSLPFEGSTHYRDEFQVKPLPPATKVTEVKLPPSLPFDATSMYRSDYVAKSNPICPVSKLPQYPAATYPQNHVFWDPDTKQWY

Entity 2 Entity 2 polymer

Description description	Tubulin alpha chain
Molecular weight formula_weight	50166.6 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,A2,A4,A6,A8,B0,B2,B4,B6,B8,C0,C2,C4,C6,C8,D0,D2,D4,D6,D8,E0,E2,E4,E6,E8,F0

MREVISIHVGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGKHVPRCVFLDLEPTVVDEVRTGTYRHLFHPEQLISGKEDAANNFARGHYTIGKEIVDLSLDRIRKLADNCTGLQGFLMFNAVGGGTGSGLGCLLLERLSVDYGKKSKLNFCSWPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRNLDIERPTYTNLNRLIAQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRMDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIETAEGEGEEEGYGDEY

Entity 3 Entity 3 polymer

Description description	Tubulin beta chain
Molecular weight formula_weight	50119.1 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A3,A5,A7,A9,B1,B3,B5,B7,B9,C1,C3,C5,C7,C9,D1,D3,D5,D7,D9,E1,E3,E5,E7,E9,F1

MREIVHVQGGQCGNQIGAKFWEVISDEHGIDPTGTYCGDSDLQLERINVFYNEATGGRFVPRAILMDLEPGTMDSVRAGPFGQLFRPDNFVFGQTGAGNNWAKGHYTEGAELIDSVLDVVRKEAEGCDCLQGFQITHSLGGGTGSGMGTLLISKVREEYPDRIMETFSVFPSPKVSDTVVEPYNATLSVHQLVENADEVQVIDNEALYDICFRTLKLTTPTYGDLNHLVSAAMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFLIGFAPLTSRGSQQYRALSVPELTQQMFDAKNMMCASDPRHGRYLTASAMFRGRMSTKEVDEQMLNVQNKNSSYFVEWIPNNMKSSVCDIPPKGLKMSVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFDEEEGEMGAEEGA

Entity 4 Entity 4 polymer

Description description	PDI family protein
Molecular weight formula_weight	24939.3 kDa
EC 编号 ec_number	1.8.1.8
Source method src_method	nat
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,m,n,o,p,q,r,s,t,u,v

MSQPVFASPLNVEKRRLNEERALMQAQKAGGEGVNIQLPPNYGDMDLILFPEGSLKNSNNTVIPQSHLKGKSVALYFADGADPKCASLLPFLLNYYRTMNEGGANQKIEIIFVSLDRDREAFESHRAHMPWLSIDLENPLTEILKRHFRVMKEYEVPTYGYGSRTGVPSVIVIGSDGREAQFLPICSGLEEGDRALLRWDWRNTKFASDQFHVRPTLLEQ

Entity 5 Entity 5 polymer

Description description	PDI family protein
Molecular weight formula_weight	21687.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,l,w,x

MLAADCFFGPDVVKRTQQGNYVPVRPDHFAGVSVALFFAKAGHSKCAQIVPVVRQFYKTTNFSGEKAVIEIIYVSLDKDEQDFERVRALMPWCSVEYKSCLRKKLIERYRVPNGELAFGTVRIPSTAIPLLIVIGPNGEEAGRMNFQQSDEFVLQRWDYRFNKWPGSAQRLRTLNDATDPWKKRLPQNV

▶

Resolution resolution	8.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	39122

The symmetry-released subpellicular microtubule map from detergent-extracted Toxoplasma cells

1. Protein Identity and Related Structures Protein Identity & Related Structures

Microtubule associated protein SPM1

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

PDI family protein

State in the Current Structure

Other States of the Same Protein in the Database

PDI family protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7tnq__assembly_1__model_1

7tnq__assembly_1__model_1 | I(q)

7tnq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

The symmetry-released subpellicular microtubule map from detergent-extracted Toxoplasma cells

1. Protein Identity and Related Structures Protein Identity & Related Structures

Microtubule associated protein SPM1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PDI family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PDI family protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7tnq__assembly_1__model_1

7tnq__assembly_1__model_1 | I(q)

7tnq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)