SAXSdb — 8g0q

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinetochore protein NDC80

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	DASH complex subunit DAM1,Kinetochore protein NUF2 × 1 （P33895,P53267）	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	DASH complex subunit DAM1,Kinetochore protein NUF2 × 1 （P33895,P53267）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDC80_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–216； UniProt 106–318 Author chain A； PDBConstruct 217–287； UniProt 621–691 Author chain C； PDBConstruct 4–216； UniProt 106–318 Author chain C； PDBConstruct 217–287； UniProt 621–691

DASH complex subunit DAM1,Kinetochore protein NUF2

Saccharomyces cerevisiae

UniProt P33895

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Kinetochore protein NDC80 × 1 （P40460）	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Kinetochore protein NDC80 × 1 （P40460）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUF2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 37–188； UniProt 2–153 Author chain B； PDBConstruct 189–233； UniProt 407–451 Author chain D； PDBConstruct 37–188； UniProt 2–153 Author chain D； PDBConstruct 189–233； UniProt 407–451

DASH complex subunit DAM1,Kinetochore protein NUF2

Saccharomyces cerevisiae

UniProt P53267

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 2	Kinetochore protein NDC80 × 1 （P40460）	Consistent with protein count
2	Insufficient information	Heteromer	Protein 2	Kinetochore protein NDC80 × 1 （P40460）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAM1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–20； UniProt 252–270 Author chain B； PDBConstruct 21–36； UniProt 290–305 Author chain D； PDBConstruct 2–20； UniProt 252–270 Author chain D； PDBConstruct 21–36； UniProt 290–305

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8g0q
Deposition date deposition_date	2023-02-01
Structure title title	Crystal structure of the yeast Ndc80:Nuf2 head region with a bound Dam1 segment
Keywords keywords	;Cell division, chromosome segregation, kinetochore, Ndc80 complex, Ndc80, Nuf2, Dam1, DASH-Dam1 complex, phospho-regulation, CELL CYCLE ;; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8g0q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8g0q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8g0q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.64 Å
Rg (electron density)	38.85 Å
Total Rg	38.59 Å
Atom count	8260
Residues	499
Excluded volume	73767 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8g0q__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8g0q__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Kinetochore protein NDC80
Molecular weight formula_weight	34124.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	15883

SGSSLQQHLSNRDPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPISIKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIENEIYQILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQEITILSQPLKTLDEQDQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDVTSTELKLEELKVDLNRKRYKLHQQVIHVIDITSKFKINIQSSLENSENELGNVIEELRNLEFETEHNVTN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DASH complex subunit DAM1,Kinetochore protein NUF2
Molecular weight formula_weight	26892.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MKLRRKSILHTIRNSIASGARISLGSGAARVVNGPVSRNQDVFPILDLQELVICLQSCDFALATQENISRPTSDYMVTLYKQIIENFMGISVESLLNSSNQETGDGHLQEENENIYLDTLNVLVLNKICFKFFENIGVQDFNMTDLYKPEAQRTQRLLSAVVNYARFREERMFDCNSFILQMESLLGQINKLNDEIKQLQKDFEVEVKEIEIEYSLLSGHINKYMNEMLEYMQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	8g0qA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	418 — Actin-binding Protein, T-fimbrin; domain 1
Homologous superfamily homologous superfamily	30 — Ncd80 complex, Ncd80 subunit

Domain ID domain_id	8g0qC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	418 — Actin-binding Protein, T-fimbrin; domain 1
Homologous superfamily homologous superfamily	30 — Ncd80 complex, Ncd80 subunit

▶

Unit-cell length a length_a	129.997 Å
Unit-cell length b length_b	129.997 Å
Unit-cell length c length_c	216.308 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 1 2
Space-group number int_tables_number	153
Crystal system crystal_system	trigonal

Resolution resolution	3.220 Å
Low-resolution limit resolution_low	99.860 Å
R factor r_factor	0.2640
R_work r_work	0.2629
R_free r_free	0.2847

Crystal structure of the yeast Ndc80:Nuf2 head region with a bound Dam1 segment

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinetochore protein NDC80

State in the Current Structure

Other States of the Same Protein in the Database

DASH complex subunit DAM1,Kinetochore protein NUF2

State in the Current Structure

Other States of the Same Protein in the Database

DASH complex subunit DAM1,Kinetochore protein NUF2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8g0q__assembly_1__model_1

8g0q__assembly_1__model_1 | I(q)

8g0q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of the yeast Ndc80:Nuf2 head region with a bound Dam1 segment

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinetochore protein NDC80

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAM1,Kinetochore protein NUF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAM1,Kinetochore protein NUF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8g0q__assembly_1__model_1

8g0q__assembly_1__model_1 | I(q)

8g0q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)