8q85

Outer kinetochore Dam1 protomer monomer Ndc80-Nuf2 coiled-coil complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinetochore protein NDC80

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDC80_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–691； UniProt 1–691

Kinetochore protein NUF2

Saccharomyces cerevisiae

UniProt P33895

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUF2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–451； UniProt 1–451

DASH complex subunit DAM1

Saccharomyces cerevisiae

UniProt P53267

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAM1_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–343； UniProt 1–343

DASH complex subunit DUO1

Saccharomyces cerevisiae

UniProt P53168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DUO1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain V； PDBConstruct 1–247； UniProt 1–247

DASH complex subunit DAD2

Saccharomyces cerevisiae

UniProt P36162

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAD2_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain W； PDBConstruct 1–133； UniProt 1–133

DASH complex subunit DAD1

Saccharomyces cerevisiae

UniProt Q12248

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAD1_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain X； PDBConstruct 1–94； UniProt 1–94

DASH complex subunit DAD4

Saccharomyces cerevisiae

UniProt P69851

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAD4_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Y； PDBConstruct 1–72； UniProt 1–72

DASH complex subunit DAD3

Saccharomyces cerevisiae

UniProt P69850

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAD3_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Z； PDBConstruct 1–94； UniProt 1–94

DASH complex subunit SPC34

Saccharomyces cerevisiae

UniProt P36131

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPC34_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain a； PDBConstruct 1–295； UniProt 1–295

DASH complex subunit ASK1

Saccharomyces cerevisiae

UniProt P35734

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit HSK3 × 1 （P69852） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ASK1_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain b； PDBConstruct 1–292； UniProt 1–292

DASH complex subunit HSK3

Saccharomyces cerevisiae

UniProt P69852

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit SPC19 × 1 （Q03954）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HSK3_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain c； PDBConstruct 1–69； UniProt 1–69

DASH complex subunit SPC19

Saccharomyces cerevisiae

UniProt Q03954

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Kinetochore protein NDC80 × 1 （P40460） Kinetochore protein NUF2 × 1 （P33895） DASH complex subunit DAM1 × 1 （P53267） DASH complex subunit DUO1 × 1 （P53168） DASH complex subunit DAD2 × 1 （P36162） DASH complex subunit DAD1 × 1 （Q12248） DASH complex subunit DAD4 × 1 （P69851） DASH complex subunit DAD3 × 1 （P69850） DASH complex subunit SPC34 × 1 （P36131） DASH complex subunit ASK1 × 1 （P35734） DASH complex subunit HSK3 × 1 （P69852）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPC19_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain d； PDBConstruct 1–165； UniProt 1–165

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8q85
Deposition date deposition_date	2023-08-17
Structure title title	Outer kinetochore Dam1 protomer monomer Ndc80-Nuf2 coiled-coil complex
Keywords keywords	Kinetochore, microtubule, error correction, chromosome segregation, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8q85__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8q85__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8q85__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.16 Å
Rg (electron density)	57.03 Å
Total Rg	55.96 Å
Atom count	10299
Residues	1436
Excluded volume	179710 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8q85__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Kinetochore protein NDC80
Molecular weight formula_weight	80609.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F
Atom count atom_count	10299

MQSSTSTDQHVLHHMDPHRFTSQIPTATSSQLRRRNSTNQGLTDMINKSIARNTISGTGIPTGGINKNKRTRSTVAGGTNGTALALNDKSNSRNSVSRLSINQLGSLQQHLSNRDPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPISIKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIENEIYQILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQEITILSQPLKTLDEQDQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDIANLQTQNDNLYEKYQEVMKISQKIKTTREKWKALKSDSNKYENYVNAMKQKSQEWPGKLEKMKSECELKEEEIKALQSNISELHKILRKKGISTEQFELQNQEREKLTRELDKINIQSDKLTSSIKSRKLEAEGIFKSLLDTLRQYDSSIQNLTRSRSQLGHNVNDSSLKINISENLLDRDFHEGISYEQLFPKGSGINESIKKSILKLNDEIQERIKTIEKDNITLEKDIKNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLVAQRIEIEKMEKKINDSNLLMKTKISDAEELVTSTELKLEELKVDLNRKRYKLHQQVIHVIDITSKFKINIQSSLENSENELGNVIEELRNLEFETEHNVTN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Kinetochore protein NUF2
Molecular weight formula_weight	53025.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSRNQDVFPILDLQELVICLQSCDFALATQENISRPTSDYMVTLYKQIIENFMGISVESLLNSSNQETGDGHLQEENENIYLDTLNVLVLNKICFKFFENIGVQDFNMTDLYKPEAQRTQRLLSAVVNYARFREERMFDCNSFILQMESLLGQLRSKFDDYNLIQQQLKQYEDVDGDNIPDEQELQKLEEQNKELEIQLKKLTKIQETLSIDYNDYKISKQSIFKDLEALSFQIVELESNRDKLIKISNTDMEELSEGIKELNDLLIQRKKTLDDLTAQQKNLQDTVTTFETIISELYDVLRIISSEVQESNRTETELVGLKQNLINNKLKLMNVLETGIMYKLEILQEQLDLQLKNLEKLSQDTKEESRLNDTKLMDLQIKYENEIKPKIDKTDIFIQEELISGKINKLNDEIKQLQKDFEVEVKEIEIEYSLLSGHINKYMNEMLEYMQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	DASH complex subunit DAM1
Molecular weight formula_weight	38477.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MSEDKAKLGTTRSATEYRLSIGSAPTSRRSSMGESSSLMKFADQEGLTSSVGEYNENTIQQLLLPKIRELSDSIITLDSNFTRLNFIHESLADLNESLGSLLYGIMSNSWCVEFSQAPHDIQDDLIAIKQLKSLEDEKNNLVMELSNMERGIKRKKDEQGENDLAKASQNKQFNQPLFPSSQVRKYRSYDNRDKRKPSKIGNNLQVENEEDYEDDTSSEASFVLNPTNIGMSKSSQGHVTKTTRLNNNTNSKLRRKSILHTIRNSIASGADLPIENDNVVNLGDLHPNNRISLGSGAARVVNGPVTKNRNSMFSGRAERKPTESRHSVAKKTEKKINTRPPFR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	DASH complex subunit DUO1
Molecular weight formula_weight	27515.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MSEQSQLDDSTIDKLIPQIFNEMRSNLNNTTNKFPKSTGGGASDNISANSNSIRSFNSITTQSLLKESESLDKITAMIKNVTAALKNNLPVYVNQVHEVCKSTNSILDSWINIHSQAGYIHKLMSDQTYLKLINDRLHNENVNTNDEDGSTLHNVIALKKKEILDLRQKLENRKGEKDAAPAKPPNQGLNPRYGVQSGRRPVPSAGISNNGRVRKTHVPASKRPSGIPRVTNRWTKPTASSSRKMFR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	DASH complex subunit DAD2
Molecular weight formula_weight	15084.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDSIDEQIAIKRKELQSLQKITSLTDGLKIQLTELNEQIKEMGMNADSVAQLMNNWDSIINNISQASLGLLQYAEGDYEIGPWKDSKKKESEQSNETGLEAQENDKNDEDNDEDEDLVPLPETMVRIRVDGNE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	DASH complex subunit DAD1
Molecular weight formula_weight	10522.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MMASTSNDEEKLISTTDKYFIEQRNIVLQEINETMNSILNGLNGLNISLESSIAVGREFQSVSDLWKTLYDGLESLSDEAPIDEQPTLSQSKTK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	DASH complex subunit DAD4
Molecular weight formula_weight	8164.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MENPHEQVQANILSRIIGNVKRLNESVAILNQELVTINNRNKNLEIMGAICDNYHSSVQFNLEATNNKKPPL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	DASH complex subunit DAD3
Molecular weight formula_weight	10862.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MEHNLSPLQQEVLDKYKQLSLDLKALDETIKELNYSQHRQQHSQQETVSPDEILQEMRDIEVKIGLVGTLLKGSVYSLILQRKQEQESLGSNSK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	DASH complex subunit SPC34
Molecular weight formula_weight	34131.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MGESLDRCIDDINRAVDSMSTLYFKPPGIFHNAILQGASNKASIRKDITRLIKDCNHDEAYLLFKVNPEKQSVSRRDGKEGVFDYVIKRDTDMKRNRRLGRPGEKPIIHVPKEVYLNKDRLDLNNKRRRTATTSGGGLNGFIFDTDLIGSSVISNSSSGTFKALSAVFKDDPQIQRLLYALENGSVLMEEESNNQRRKTIFVEDFPTDLILKVMAEVTDLWPLTEFKQDYDQLYHNYEQLSSKLRFIKKEVLLQDDRLKTMSQYHPSSSHDVAKIIRKEKDEIRRLEMEIANLQE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	DASH complex subunit ASK1
Molecular weight formula_weight	32106.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MDSASKEETLEKLDQEITVNLQKIDSNLSFCFHKITQDIIPHVATYSEICERIMDSTEWLGTMFQETGLVNLQANAAAPVGNAPVKSLVSNNVGIFPTSAEEASRQSQTDNGPNEADSAVHVNRDVHSMFNNDSIDDFHTANITSTGQILKLPDSSDEDTGSEAVPSREQTDLTGEGHGGADDEQDESTIQRQSRKRKISLLLQQQYGSSSSMVPSPIVPNKMRKQLAHEEHINNDGDNDDENSNNIESSPLKQGHHHPKGQADDNNEGPDEEESTKEVPKPGTIIHFSTNR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	DASH complex subunit HSK3
Molecular weight formula_weight	8097.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MNANKQRQYNQLAHELRELQTNLQETTKQLDIMSKQCNENLVGQLGKVHGSWLIGSYIYYMEQMLGKTQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	DASH complex subunit SPC19
Molecular weight formula_weight	18935.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MTDALEQSVLALEGTVSVLKDSVESLKCANEPSTNLASTMLQTKRVFRLVPEYDVERSKLDLIEEVEPLVRTLGDKLRKSMGRMQRELDTLQQTYELNDLRLKKNISMDDDDALNSPDMGQEYEGRDADDVVMMASSTNEELEELKKLKEKKKQLENKLEILKQK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.97 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	77272

Outer kinetochore Dam1 protomer monomer Ndc80-Nuf2 coiled-coil complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinetochore protein NDC80

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Kinetochore protein NUF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAM1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DUO1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAD2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAD1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAD4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit DAD3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit SPC34

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DASH complex subunit ASK1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer