8oop

CryoEM Structure INO80core Hexasome complex composite model state2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RuvB-like protein 1

Thermochaetoides thermophila

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYI5_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–462； UniProt 1–462 Author chain B； PDBConstruct 1–462； UniProt 1–462 Author chain C； PDBConstruct 1–462； UniProt 1–462

RuvB-like protein 2

Thermochaetoides thermophila

UniProt G0RYC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYC2_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–488； UniProt 1–488 Author chain E； PDBConstruct 1–488； UniProt 1–488 Author chain F； PDBConstruct 1–488； UniProt 1–488

Ino eighty subunit 2

Thermochaetoides thermophila

UniProt G0RY01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RY01_CHATD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–492； UniProt 1–492

Chromatin-remodeling complex subunit IES6

Thermochaetoides thermophila

UniProt G0S590

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S590_CHATD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–219； UniProt 1–219

Actin-related protein 5

Thermochaetoides thermophila

UniProt G0S589

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S589_CHATD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 1–769； UniProt 98–866

Histone H3.1

Homo sapiens

UniProt P68431

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H31_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–135； UniProt 2–136 Author chain Q； PDBConstruct 1–135； UniProt 2–136

Histone H4

Homo sapiens

UniProt P62805

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H2A × 1 （Q93077） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H4_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain N； PDBConstruct 1–102； UniProt 2–103 Author chain R； PDBConstruct 1–102； UniProt 2–103

Histone H2A

Homo sapiens

UniProt Q93077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2B × 1 （P62807） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2A1C_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–129； UniProt 2–130

Histone H2B

Homo sapiens

UniProt P62807

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 16 DNA 2	RuvB-like protein 1 × 3 （G0RYI5） RuvB-like protein 2 × 3 （G0RYC2） Chromatin-remodeling ATPase Ino80 × 1 Ino eighty subunit 2 × 1 （G0RY01） Chromatin-remodeling complex subunit IES6 × 1 （G0S590） Actin-related protein 5 × 1 （G0S589） DNA strand 1 × 1 DNA Strand 2 × 1 Histone H3.1 × 2 （P68431） Histone H4 × 2 （P62805） Histone H2A × 1 （Q93077） ADENOSINE-5'-DIPHOSPHATE × 7 MAGNESIUM ION × 2 TETRAFLUOROALUMINATE ION × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B1C_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–125； UniProt 2–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oop
Deposition date deposition_date	2023-04-05
Structure title title	CryoEM Structure INO80core Hexasome complex composite model state2
Keywords keywords	ATP-dependent chromatin remodeler, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8oop__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8oop__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8oop__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.93 Å
Rg (electron density)	59.68 Å
Total Rg	59.88 Å
Atom count	40747
Residues	4894
Excluded volume	710620 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8oop__assembly_1__model_1`	18-meric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	RuvB-like protein 1
Molecular weight formula_weight	50451.8 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	40747

MVQISEVRGNTRDHRTAAHTHIKGLGLNSSGIAEKQAAGFVGQCAAREACGVVVDLIKAHKMAGRGVLLAGGPGTGKTALALAISQELGTKIPFCPITGSEIYSTEVKKTEVLMENFRRAIGLRVRETKDVYEGEVTEMTPEEAENPLGGYGKTISTLLIGLKSARGQKKLRLDPSIYEAIQKERVQVGDVIYIETNTGACKRVGRSDAYATEFDLEAEEYVPIPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDIISMMGQLMKPKMTEITDKLRMEINKVVQKYINQGVAELIPGVLFIDEAHMLDIECFTYLNKALESPIAPIVVLASNRGIATIRGADDLKAAHGIPPDFLQRLLIIPTHPYEPDEIRRIVRIRAQTEGVQLTDAAVDRVAEHGVRISLRYCLQLLAPASILARVNGRTQVDVQDIAEAEELFLDARRSANILTSTGESGGLHGFIS

Source Source

Source organism organism	Thermochaetoides thermophila
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	RuvB-like protein 2
Molecular weight formula_weight	53212.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MAAPLVTSVTETKELRGLNLIAAHSHIRGLGVDADTLEPRPSSQGLVGQEKARKAAAVVLEMIKQGKIAGRAVLIAGPPSTGKTAIAMGMAQSLGQDVPFTTLAASEIFSLEMSKTEALTQAFRKSIGVRIKEESEIMEGEVVEIQIDRSVTGGAKQGKLTIKTTDMEAIYDMGSKMIDAMTKERVMAGDIISIDKSSGKITKLGRSYARSRDYDAMGVDTKFLQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIRSEIRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSYINRALESDLAPIVIMASNRGVSRIRGTDYKSPHGLPLDFLDRVVIINTHPYTPDELRQILSIRAQEEEVDLTPDALALLTKIGQEAGLRYASNLITTSQLIAAKRRAKQVGVEDVQRSFKLFYDPARSVRFVQESEKRLIGNDGVVDFSYQGAAEAAAPTLPAAAPVDPVGGEKMDMS

Source Source

Source organism organism	Thermochaetoides thermophila
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Chromatin-remodeling ATPase Ino80
Molecular weight formula_weight	130887.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LELKFQSKGYNQIYDQIWRDLARKDVSKVFRLATDSYATKASNLKKTAILASKEAKRWQLRTNKGTKDLQARAKRVMRDMMGFWKRNEREERDLRKAAERLELENARKEEADREAARQRRKLNFLISQTELYSHFISKKIKTHEVERSTDHPDVATDEKDKIPEPTLNINVPEPTGPIAPKVTDFNSLDFDNEDESALQAAAMANAQNAIAEAQKKAREFNKDETKLDEDGEMNFQHPELTEFEVAQPKLLNCQLKEYQLKGLNWLVNLYEQGINGILADEMGLGKTVQSISVMAYLAERYDIWGPFLVVAPASTLHNWQQEVSKFVPDFKVLPYWGTAADRKVLRKFWDRKHTTYKKDSPFHVMITSYQLVVSDVAYFQKMKWQYMILDEAQAIKSSQSSRWKCLLGFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDSHDEFSEWFSKDIESHAQSNTKLNEDQLKRLHMILKPFMLRRVKKHVQKELGDKIEIDVFCELSYRQRAMYQSLRNQISIMDLIEKATVGDNEDSATLMNLVMQFRKVCNHPDLFERADTSSPFFCGHFAETGSFLREGTNVALGYSTRSLVEYRLPRLIWCDGGRLDKPGPGNLVAGFRSKYLNHMMNIWTPENIRSSLEGIENFTWLRFVDTSLQEAYRASHTDVFARAVDLASKQNRLGHMQIVYDEPEDKKWTPVHALFQICERENPKAVAEITTEGVLRDLMNIARVKYRELGLCRLEKAARPRASAPPIEVVCDSRSAVIERENIMFHPAMRKALFGPTPSEIKEASFGPRPVTLYPPRALLPAPDHDKQRFTNITVPSMARFVTDSGKLAKLDELLRELKEGGHRVLLYFQMTRMIDLMEEYLTYRNYKYCRLDGSTKLEDRRDTVADFQTRPEIFIFLLSTRAGGLGINLTTADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVYRLITRGTIEERIRKRALQKEEVQRVVITGTGSVDFSGRRPPENRNRDIAMWLADDEQAEMIERREKELIESGEYDKIMQQRRKGGKRKRGAANGDTVPSLEDMYHEGEGHFDDNKGSGAATPVDADSLGRGGKRKKAGGSKKAKTTKQRLAIADGEIDIDYKDDDDKGTDYKDDDDK

Source Source

Source organism organism	Thermochaetoides thermophila
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Ino eighty subunit 2
Molecular weight formula_weight	53346.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSTRPRRHAAQRASQAITDLADRDRESDHSHGPISSRMSSFNSSSRSRLPGKGIASVSRSEAGGASDPEHIHLTVKLPSSKLRQATSSSGIKKAGSVGSSSSSSGGGKAAVKRARGGKRSRVLESSEEEEEENEVEVLGDEDEEEEEEEDEIEVREGEGYDEDEEDVEDEDEEMQDLGEEDADGEDDEMDVDAEGEEDADGDVNMDAGVVGARATTVRAVPPAIKVTKPPKESPSNGKAATASKANDNAVPVKRPAPDSDDESLSSLESEPEEEVNVAGGEDAEGEDDDAEGEVDAEGEEEEEEEEIEVADEDAEGEDVEQDEDEDEEEEDDDDEMISRAQTPDMSRLTARQRARLGEASGEYLKLSDEVQSKKHFTAEELSMRRAEMARRRRNLSEKRNEEIKMETVNKLLKKQAPRTTRRAAQAAAAAEEAEEAAKQPKRPDPMMIRWVNNKMGSVVAVPEELLGTHAGVVFGAGPGKGLPAGKMVEEVS

Source Source

Source organism organism	Thermochaetoides thermophila
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Chromatin-remodeling complex subunit IES6
Molecular weight formula_weight	23127.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSNPDAQSAQAAHQALVEQLDLHSIHKTFRNPNWRPNQRRNKTIKAILGESQRKEASSTSAVATPRADDNGGGSGADTPANNDNNDGLSTSGTSTPANGNGSGAGTPASNGQPNLAQASRSLQKLVLEKSLASAQAPDKKAANGFASSAPTATYTNIESAPSLAPMKHYCDVTGLPAPYLDPKTRLRYHNKEIFAMIRNLPQGMGEQFLEARGAHTVLK

Source Source

Source organism organism	Thermochaetoides thermophila
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Actin-related protein 5
Molecular weight formula_weight	87773.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAPSAVAEPPPIPQRDEPWKRLPPPTVYPVKEARFEKYIPPQLDGRERALAQPPGQVAIVIDNGSHSVRAGWNFEDKPRLAIPPIMSKYRDRKMGKTFSFAGSDCYADTTARSHIRNAFEAGTGIVSNWDVMEHVLDYVFVKLGMNECDGAIDMPIVMTEAVANLPYSRKSMSEIIFECYGAPSLVYGIDSLFSFRHNQGQTGLVVSSSYSATHVIPVYNRKALLSQAIRLNWGGWHMAEYMLKLLKLKYYTGFPGKLNSSQTEHMVRDFCYVSLDYDRELAGYLDWTGLEDRERIVQYPYTEEVVVQKTEEELARIAERKKESGRRLQEQAAKMRLERLMKKEQELEYYKDIQRRMQGESKKEIKRLLDEAELKDEAALERVIRDLERSIKRARQKDLGEPEEEEVPDFSLLDVPDDQLDEAGLRQKRQQRLLKSNWEARQRAKAEKEAEKARLAEEARLDEERRKNDLEGWLEEKRQLRLAKLNQLKERERLKADLGNRKSLASQIRMKNIANLASDNPTGSGSRKRRRGGAGADQDDDFGADDADWGVYRSVAIGANKGDDSDDEEGEEDLEAAIRSLENDLLRYDKTFSYDMTLDAQRDWSKSLLHAFRYGPRPFDPSSQAETHRVHLNVERIRVPEVLFQPAAIAGVDQAGLVEIAGDILCQRLPSLPGIQDAPDAFLRDVFLTGGNTLFQNFDERLRQGLMALLPVGAPLRVRRAQDAILDAWRGAAGWACTEEAKAAWITREEYLEKGGEYIKEHDLGNAFA

Source Source

Source organism organism	Thermochaetoides thermophila
NCBI taxonomy ID ncbi_taxonomy_id	209285
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	DNA strand 1
Molecular weight formula_weight	69527.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	K

CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGCAAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCATGTATTGAACAGCGACCTTGCCGGTGCCAGTCGGATAGTGTTCCGAGCTCCCACTCTAGAGGATCCCCGGGTACCG

Entity 8 Entity 8 polymer

Description description	DNA Strand 2
Molecular weight formula_weight	70043.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	L

CGGTACCCGGGGATCCTCTAGAGTGGGAGCTCGGAACACTATCCGACTGGCACCGGCAAGGTCGCTGTTCAATACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTTGCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAG

Entity 9 Entity 9 polymer

Description description	Histone H3.1
Molecular weight formula_weight	15306.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,Q

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Histone H4
Molecular weight formula_weight	11263.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,R

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Histone H2A
Molecular weight formula_weight	14004.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Histone H2B
Molecular weight formula_weight	13806.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 13 Entity 13 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 14 Entity 14 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	TETRAFLUOROALUMINATE ION
Molecular weight formula_weight	103.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	98967

CryoEM Structure INO80core Hexasome complex composite model state2

1. Protein Identity and Related Structures Protein Identity & Related Structures

RuvB-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ino eighty subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin-remodeling complex subunit IES6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8oop__assembly_1__model_1

8oop__assembly_1__model_1 | I(q)

8oop__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment