8qyl

Human 20S proteasome assembly intermediate structure 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

Homo sapiens

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit alpha type-7

Homo sapiens

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–248； UniProt 1–248

Proteasome subunit alpha type-5

Homo sapiens

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 2–242； UniProt 1–241

Proteasome subunit alpha type-1

Homo sapiens

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 2–264； UniProt 1–263

Proteasome subunit alpha type-3

Homo sapiens

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–255； UniProt 1–255

Proteasome subunit alpha type-6

Homo sapiens

UniProt P60900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–246； UniProt 1–246

Proteasome maturation protein

Homo sapiens

UniProt Q9Y244

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POMP_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–141； UniProt 1–141

Proteasome assembly chaperone 1

Homo sapiens

UniProt O95456

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMG1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–288； UniProt 1–288

Proteasome assembly chaperone 2

Homo sapiens

UniProt Q969U7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome subunit beta type-7 × 1 （Q99436） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMG2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 2–265； UniProt 1–264

Proteasome subunit beta type-7

Homo sapiens

UniProt Q99436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-3 × 1 （P49720）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–277； UniProt 1–277

Proteasome subunit beta type-3

Homo sapiens

UniProt P49720

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Proteasome subunit alpha type-2 × 1 （P25787） Proteasome subunit alpha type-4 × 1 （P25789） Proteasome subunit alpha type-7 × 1 （O14818） Proteasome subunit alpha type-5 × 1 （P28066） Proteasome subunit alpha type-1 × 1 （P25786） Proteasome subunit alpha type-3 × 1 （P25788） Proteasome subunit alpha type-6 × 1 （P60900） Proteasome maturation protein × 1 （Q9Y244） Proteasome assembly chaperone 1 × 1 （O95456） Proteasome assembly chaperone 2 × 1 （Q969U7） Proteasome subunit beta type-7 × 1 （Q99436）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–205； UniProt 1–205

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qyl
Deposition date deposition_date	2023-10-26
Structure title title	Human 20S proteasome assembly intermediate structure 2
Keywords keywords	Complex, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qyl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qyl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qyl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.60 Å
Rg (electron density)	45.07 Å
Total Rg	45.49 Å
Atom count	20997
Residues	2691
Excluded volume	375880 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qyl__assembly_1__model_1`	12-meric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25927.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	20997

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29525.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27929.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26462.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

XMFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29621.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

XMFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28469.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27432.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Proteasome maturation protein
Molecular weight formula_weight	15805.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Proteasome assembly chaperone 1
Molecular weight formula_weight	32891.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Proteasome assembly chaperone 2
Molecular weight formula_weight	29449.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

XMFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	35490.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTSEDLYFQSVDSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKXXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22972.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.67 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	322874

Human 20S proteasome assembly intermediate structure 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome maturation protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome assembly chaperone 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome assembly chaperone 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer