8qys

Human preholo proteasome 20S core particle

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234 Author chain R； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

Homo sapiens

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–248； UniProt 3–250 Author chain S； PDBConstruct 1–248； UniProt 3–250

Proteasome subunit alpha type-7

Homo sapiens

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–234； UniProt 3–236 Author chain T； PDBConstruct 1–234； UniProt 3–236

Proteasome subunit alpha type-5

Homo sapiens

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–240； UniProt 1–240 Author chain U； PDBConstruct 1–240； UniProt 1–240

Proteasome subunit alpha type-1

Homo sapiens

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–241； UniProt 1–241 Author chain V； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit alpha type-3

Homo sapiens

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–241； UniProt 5–245 Author chain W； PDBConstruct 1–241； UniProt 5–245

Proteasome subunit alpha type-6

Homo sapiens

UniProt P60900

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–244； UniProt 1–244 Author chain X； PDBConstruct 1–244； UniProt 1–244

Proteasome maturation protein

Homo sapiens

UniProt Q9Y244

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POMP_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–141； UniProt 1–141 Author chain Y； PDBConstruct 1–141； UniProt 1–141

Proteasome assembly chaperone 1

Homo sapiens

UniProt O95456

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMG1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–288； UniProt 1–288 Author chain Z； PDBConstruct 1–288； UniProt 1–288

Proteasome assembly chaperone 2

Homo sapiens

UniProt Q969U7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMG2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–264； UniProt 1–264 Author chain a； PDBConstruct 1–264； UniProt 1–264

Proteasome subunit beta type-7

Homo sapiens

UniProt Q99436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–262； UniProt 2–263 Author chain b； PDBConstruct 1–262； UniProt 2–263

Proteasome subunit beta type-3

Homo sapiens

UniProt P49720

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–203； UniProt 3–205 Author chain c； PDBConstruct 1–203； UniProt 3–205

Proteasome subunit beta type-2

Homo sapiens

UniProt P49721

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–197； UniProt 1–197 Author chain d； PDBConstruct 1–197； UniProt 1–197

Proteasome subunit beta type-5

Homo sapiens

UniProt P28074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–208； UniProt 52–259 Author chain e； PDBConstruct 1–208； UniProt 52–259

Proteasome subunit beta type-1

Homo sapiens

UniProt P20618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-4 × 2 （P28070） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–212； UniProt 30–241 Author chain f； PDBConstruct 1–212； UniProt 30–241

Proteasome subunit beta type-4

Homo sapiens

UniProt P28070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-6 × 2 （P28072）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain P； PDBConstruct 1–208； UniProt 50–257 Author chain g； PDBConstruct 1–208； UniProt 50–257

Proteasome subunit beta type-6

Homo sapiens

UniProt P28072

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 34	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit alpha type-6 × 2 （P60900） Proteasome maturation protein × 2 （Q9Y244） Proteasome assembly chaperone 1 × 2 （O95456） Proteasome assembly chaperone 2 × 2 （Q969U7） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Q； PDBConstruct 1–197； UniProt 35–231 Author chain h； PDBConstruct 1–197； UniProt 35–231

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qys
Deposition date deposition_date	2023-10-26
Structure title title	Human preholo proteasome 20S core particle
Keywords keywords	Complex, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qys__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qys__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qys__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.23 Å
Rg (electron density)	67.50 Å
Total Rg	67.56 Å
Atom count	57862
Residues	7588
Excluded volume	1033000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qys__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25927.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,R
Atom count atom_count	57862

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	27901.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,S

RRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAERE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	26278.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,T

YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26322.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,U

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	27164.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,V

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	26870.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,W

GTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27160.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,X

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Proteasome maturation protein
Molecular weight formula_weight	15805.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,Y

MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Proteasome assembly chaperone 1
Molecular weight formula_weight	32891.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,Z

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Proteasome assembly chaperone 2
Molecular weight formula_weight	29423.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,a

MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYATTEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIVLSSSHSYQRNDLQLRSTPFRYLLTPSMQKSVQNKIKSLNWEEMEKSRCIPEIDDSEFCIRIPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQILKPLSDDPTVSASRWKIPSSWRLLFGSGLPPALF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	28292.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,b

AAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22754.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,c

IMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22462.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,d

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	22978.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,e

PGIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	23421.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,f

FSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 16 Entity 16 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	23159.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,g

MVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQTATVTEKGVEIEGPLSTETNWDIA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 17 Entity 17 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	21158.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,h

TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQGYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.89 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	59535

Human preholo proteasome 20S core particle

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome maturation protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome assembly chaperone 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome assembly chaperone 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer