9qvx

The targeting of non-fibrillar polyQ via distinct VCP-proteasome coupling

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-6

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–240； UniProt 3–242 Author chain O； PDBConstruct 1–240； UniProt 3–242

Proteasome subunit alpha type-2

Homo sapiens

UniProt P25787

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–229； UniProt 4–232 Author chain P； PDBConstruct 1–229； UniProt 4–232

Proteasome subunit alpha type-4

Homo sapiens

UniProt P25789

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–247； UniProt 2–248 Author chain Q； PDBConstruct 1–247； UniProt 2–248

Proteasome subunit alpha type-7

Homo sapiens

UniProt O14818

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–232； UniProt 2–233 Author chain R； PDBConstruct 1–232； UniProt 2–233

Proteasome subunit alpha type-5

Homo sapiens

UniProt P28066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–233； UniProt 9–241 Author chain S； PDBConstruct 1–233； UniProt 9–241

Proteasome subunit alpha type-1

Homo sapiens

UniProt P25786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–233； UniProt 4–236 Author chain T； PDBConstruct 1–233； UniProt 4–236

Proteasome subunit alpha type-3

Homo sapiens

UniProt P25788

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–239； UniProt 7–245 Author chain U； PDBConstruct 1–239； UniProt 7–245

Proteasome subunit beta type-6

Homo sapiens

UniProt P28072

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–202； UniProt 35–236 Author chain V； PDBConstruct 1–202； UniProt 35–236

Proteasome subunit beta type-7

Homo sapiens

UniProt Q99436

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–220； UniProt 44–263 Author chain W； PDBConstruct 1–220； UniProt 44–263

Proteasome subunit beta type-3

Homo sapiens

UniProt P49720

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–204； UniProt 2–205 Author chain X； PDBConstruct 1–204； UniProt 2–205

Proteasome subunit beta type-2

Homo sapiens

UniProt P49721

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–196； UniProt 1–196 Author chain Y； PDBConstruct 1–196； UniProt 1–196

Proteasome subunit beta type-5

Homo sapiens

UniProt P28074

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-1 × 2 （P20618） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–200； UniProt 60–259 Author chain Z； PDBConstruct 1–200； UniProt 60–259

Proteasome subunit beta type-1

Homo sapiens

UniProt P20618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-4 × 2 （P28070） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–212； UniProt 30–241 Author chain a； PDBConstruct 1–212； UniProt 30–241

Proteasome subunit beta type-4

Homo sapiens

UniProt P28070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Proteasome subunit alpha type-6 × 2 （P60900） Proteasome subunit alpha type-2 × 2 （P25787） Proteasome subunit alpha type-4 × 2 （P25789） Proteasome subunit alpha type-7 × 2 （O14818） Proteasome subunit alpha type-5 × 2 （P28066） Proteasome subunit alpha type-1 × 2 （P25786） Proteasome subunit alpha type-3 × 2 （P25788） Proteasome subunit beta type-6 × 2 （P28072） Proteasome subunit beta type-7 × 2 （Q99436） Proteasome subunit beta type-3 × 2 （P49720） Proteasome subunit beta type-2 × 2 （P49721） Proteasome subunit beta type-5 × 2 （P28074） Proteasome subunit beta type-1 × 2 （P20618） polypeptide traced as poly-Ala × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–212； UniProt 46–257 Author chain b； PDBConstruct 1–212； UniProt 46–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qvx
Deposition date deposition_date	2025-04-13
Structure title title	The targeting of non-fibrillar polyQ via distinct VCP-proteasome coupling
Keywords keywords	human 20S peptide co-complex, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qvx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qvx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qvx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.41 Å
Rg (electron density)	59.02 Å
Total Rg	59.12 Å
Atom count	45388
Residues	6206
Excluded volume	811660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qvx__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	26741.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,O
Atom count atom_count	45388

RGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVAL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25411.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,P

RGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	27702.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q

SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	25977.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,R

SYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	25406.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,S

DRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	26087.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,T

NQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	26712.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,U

GYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	21656.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V

TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	23745.3 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22841.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X

SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22365.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,Y

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	22142.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Z

TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	23421.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,a

FSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	23611.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,b

TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 15 Entity 15 polymer

Description description	polypeptide traced as poly-Ala
Molecular weight formula_weight	358.4 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,d

XXXX

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.900 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	43227

The targeting of non-fibrillar polyQ via distinct VCP-proteasome coupling

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer