SAXSdb — 8uz6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 7 PDB declaration: heptameric（7） Consistent with protein copy count	Chain A； UniProt 1–377 Chain B； UniProt 1–377	Not recorded	Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin I, cardiac muscle × 1 （A0A4X1V710） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） Tropomyosin alpha-1 chain × 2 （P42639） ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 7.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8UZ6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5NOG Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Blocked" state Deposited 2017-04-12	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 7–373（367 aa） Chain B 7–373（367 aa） Chain C 7–373（367 aa） Chain D 7–373（367 aa） Chain E 7–373（367 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
5NOL Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Closed" state Deposited 2017-04-12	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 7–373（367 aa） Chain B 7–373（367 aa） Chain C 7–373（367 aa） Chain D 7–373（367 aa） Chain E 7–373（367 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
7JH7 cardiac actomyosin complex Deposited 2020-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7LRG Filamentous actin decorated with human cardiac myosin binding protein C C2 domain Deposited 2021-02-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.10 Å
8DD0 The structure of the native cardiac thin filament junction region Deposited 2022-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8EFH Helical reconstruction of the human cardiac actin-tropomyosin-myosin complex in complex with ADP-Mg2+ Deposited 2022-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Not recorded	MG MAGNESIUM ION × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8EFI Helical reconstruction of the human cardiac actin-tropomyosin-myosin complex in the rigor form Deposited 2022-09-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8ENC Helical reconstruction of the human cardiac actin-tropomyosin-myosin loop 4 7G mutant complex Deposited 2022-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–377（377 aa） Chain C 1–377（377 aa） Chain D 1–377（377 aa） Chain E 1–377（377 aa） Chain F 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8UWW The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.10 Å
8UWX The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.00 Å
8UWY The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8UYD The structure of the native cardiac thin filament troponin core in Ca2+-free state from the lower strand Deposited 2023-11-13	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8UZ5 The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the lower strand Deposited 2023-11-14	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8UZX The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8UZY The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8V01 The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8V0I The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 2 from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
8V0K The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8V0Y The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand activated by the C1-domain of cardiac myosin binding protein C Deposited 2023-11-17	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–377（377 aa） Chain B 1–377（377 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å

19 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	B6VNT8_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–377； UniProt 1–377 Author chain B； PDBConstruct 1–377； UniProt 1–377

Troponin C, slow skeletal and cardiac muscles

OrganismNot specified

UniProt P63317

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 7 PDB declaration: heptameric（7） Consistent with protein copy count	Chain C； UniProt 1–161	Not recorded	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin I, cardiac muscle × 1 （A0A4X1V710） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） Tropomyosin alpha-1 chain × 2 （P42639） ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 7.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8UZ6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8UWW The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.10 Å
8UWX The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.00 Å
8UWY The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8UYD The structure of the native cardiac thin filament troponin core in Ca2+-free state from the lower strand Deposited 2023-11-13	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8UZ5 The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the lower strand Deposited 2023-11-14	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8UZX The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8UZY The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8V01 The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8V0I The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 2 from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
8V0K The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8V0Y The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand activated by the C1-domain of cardiac myosin binding protein C Deposited 2023-11-17	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–161（161 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TNNC1_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–161； UniProt 1–161

Troponin I, cardiac muscle

OrganismNot specified

UniProt A0A4X1V710

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 7 PDB declaration: heptameric（7） Consistent with protein copy count	Chain D； UniProt 1–211	Not recorded	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） Tropomyosin alpha-1 chain × 2 （P42639） ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 7.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8UZ6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8UWW The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.10 Å
8UWX The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.00 Å
8UYD The structure of the native cardiac thin filament troponin core in Ca2+-free state from the lower strand Deposited 2023-11-13	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8UZ5 The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the lower strand Deposited 2023-11-14	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8UZX The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8UZY The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8V01 The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8V0I The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 2 from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
8V0K The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8V0Y The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand activated by the C1-domain of cardiac myosin binding protein C Deposited 2023-11-17	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 1–211（211 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1V710_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–211； UniProt 1–211

Troponin T2, cardiac type

OrganismNot specified

UniProt A0A5G2Q8N0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 7 PDB declaration: heptameric（7） Consistent with protein copy count	Chain E； UniProt 1–285	Not recorded	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin I, cardiac muscle × 1 （A0A4X1V710） Tropomyosin alpha-1 chain × 2 （P42639） ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 7.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8UZ6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8UWW The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.10 Å
8UWX The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.00 Å
8UWY The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8UYD The structure of the native cardiac thin filament troponin core in Ca2+-free state from the lower strand Deposited 2023-11-13	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8UZ5 The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the lower strand Deposited 2023-11-14	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8UZX The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8UZY The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8V01 The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8V0I The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 2 from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
8V0K The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8V0Y The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand activated by the C1-domain of cardiac myosin binding protein C Deposited 2023-11-17	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–285（285 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A5G2Q8N0_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–285； UniProt 1–285

Tropomyosin alpha-1 chain

OrganismNot specified

UniProt P42639

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 7 PDB declaration: heptameric（7） Consistent with protein copy count	Chain F； UniProt 1–284 Chain G； UniProt 1–284	Not recorded	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin I, cardiac muscle × 1 （A0A4X1V710） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 7.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8UZ6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1C1G CRYSTAL STRUCTURE OF TROPOMYOSIN AT 7 ANGSTROMS RESOLUTION IN THE SPERMINE-INDUCED CRYSTAL FORM Deposited 1999-07-22	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–284（284 aa） Chain B 1–284（284 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIQUID DIFFUSION；pH 7.4；291 K；SPERMINE, pH 7.4, LIQUID DIFFUSION, temperature 18K	Resolution 7.00 Å
1C1G CRYSTAL STRUCTURE OF TROPOMYOSIN AT 7 ANGSTROMS RESOLUTION IN THE SPERMINE-INDUCED CRYSTAL FORM Deposited 1999-07-22	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–284（284 aa） Chain D 1–284（284 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIQUID DIFFUSION；pH 7.4；291 K；SPERMINE, pH 7.4, LIQUID DIFFUSION, temperature 18K	Resolution 7.00 Å
8DD0 The structure of the native cardiac thin filament junction region Deposited 2022-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain G 1–284（284 aa） Chain H 1–284（284 aa） Chain I 1–284（284 aa） Chain J 1–284（284 aa） Chain L 1–284（284 aa） Chain M 1–284（284 aa） Chain N 1–284（284 aa） Chain O 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8UWW The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.10 Å
8UWX The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.00 Å
8UWY The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the upper strand Deposited 2023-11-08	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8UYD The structure of the native cardiac thin filament troponin core in Ca2+-free state from the lower strand Deposited 2023-11-13	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8UZ5 The structure of the native cardiac thin filament troponin core in Ca2+-free rotated state from the lower strand Deposited 2023-11-14	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8UZX The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
8UZY The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the upper strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.30 Å
8V01 The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand Deposited 2023-11-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8V0I The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 2 from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.80 Å
8V0K The structure of the native cardiac thin filament troponin core in Ca2+-bound partially activated state from the lower strand Deposited 2023-11-17	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 CA CALCIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.20 Å
8V0Y The structure of the native cardiac thin filament troponin core in Ca2+-free state from the upper strand activated by the C1-domain of cardiac myosin binding protein C Deposited 2023-11-17	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain F 1–284（284 aa） Chain G 1–284（284 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.00 Å

13 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TPM1_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–284； UniProt 1–284 Author chain G； PDBConstruct 1–284； UniProt 1–284

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8uz6
Deposition date deposition_date	2023-11-14
Structure title title	The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the lower strand
Keywords keywords	thin filament, troponin, tropomyosin, cryo-EM, muscle structure, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.37 Å
Radius of gyration Rg (electron density) rg_electron	39.05 Å
Forward intensity I(0) i0	338941000.00
Molecular weight molecular_weight	146020.0 kDa
Excluded volume excluded_volume	181500 Å³
Envelope volume envelope_volume	260070 Å³
Hydration-shell volume shell_volume	56290 Å³
Envelope diameter envelope_diameter	139.5 Å
Shell Rg shell_rg	44.13 Å
Envelope Rg envelope_rg	38.70 Å
Shape Rg shape_rg	39.03 Å
Total Rg total_rg	39.40 Å
Total atoms total_atoms	10232
Residues n_residues	1281
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	128.9 Å
Rg (real space) rg_real	39.31 Å
Rg uncertainty (real space) rg_real_error	1.04 Å
I(0) (real space) i0_real	3.3890e+08
I(0) uncertainty (real space) i0_real_error	6.2740e+06
Rg (reciprocal space) rg_reciprocal	39.35 Å
I(0) (reciprocal space) i0_reciprocal	339000000.0000
Solution quality estimate total_estimate	0.8931
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	45.1 Å
Skewness Skewness skewness	0.285
Kurtosis Kurtosis kurtosis	-0.409
Angular range angular_range	— – 0.2000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	40920000.0000
Real-space data points n_real_points	41
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.911; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.874

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Actin, alpha cardiac muscle 1
Molecular weight formula_weight	42064.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	10232

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Entity 2 Entity 2 polymer

Description description	Troponin C, slow skeletal and cardiac muscles
Molecular weight formula_weight	18433.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Entity 3 Entity 3 polymer

Description description	Troponin I, cardiac muscle
Molecular weight formula_weight	24092.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MADRSGDAAGDSRPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLSFAELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLNQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKETLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFEG

Entity 4 Entity 4 polymer

Description description	Troponin T2, cardiac type
Molecular weight formula_weight	33941.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSDVEETVDEYEEEQEEGAAEEQEEAVEEEAGGEAEAEEANAEEAGQEEDGREAEDGPMEESKPKPRLFMPNLVPPKIPDGERVDFDDIHRKRMKDLNELQTLIEAHFENRKKEEELVSLKDRIEKRRAERAEQQRIRTEREKERQTRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Entity 5 Entity 5 polymer

Description description	Tropomyosin alpha-1 chain
Molecular weight formula_weight	32762.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKYSEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Resolution resolution	7.10 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	28445

fit	/app/data/saxs_computation/uz/8uz6/8uz6.fit
pddf	/app/data/pr_computation/uz/8uz6/8uz6.pr.out
profile	/app/data/saxs_computation/uz/8uz6/8uz6.dat

The structure of the native cardiac thin filament troponin core in Ca2+-free tilted state from the lower strand

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

State in the Current Structure

Other States of the Same Protein in the Database

Troponin C, slow skeletal and cardiac muscles

State in the Current Structure

Other States of the Same Protein in the Database

Troponin I, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Troponin T2, cardiac type

State in the Current Structure

Other States of the Same Protein in the Database

Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)