8v01

The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin I, cardiac muscle × 1 （A0A4X1V710） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） Tropomyosin alpha-1 chain × 2 （P42639） ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B6VNT8_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–377； UniProt 1–377 Author chain B； PDBConstruct 1–377； UniProt 1–377

Troponin C, slow skeletal and cardiac muscles

OrganismNot specified

UniProt P63317

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin I, cardiac muscle × 1 （A0A4X1V710） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） Tropomyosin alpha-1 chain × 2 （P42639） ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TNNC1_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–161； UniProt 1–161

Troponin I, cardiac muscle

OrganismNot specified

UniProt A0A4X1V710

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） Tropomyosin alpha-1 chain × 2 （P42639） ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1V710_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–211； UniProt 1–211

Troponin T2, cardiac type

OrganismNot specified

UniProt A0A5G2Q8N0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin I, cardiac muscle × 1 （A0A4X1V710） Tropomyosin alpha-1 chain × 2 （P42639） ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2Q8N0_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–285； UniProt 1–285

Tropomyosin alpha-1 chain

OrganismNot specified

UniProt P42639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Actin, alpha cardiac muscle 1 × 2 （B6VNT8） Troponin C, slow skeletal and cardiac muscles × 1 （P63317） Troponin I, cardiac muscle × 1 （A0A4X1V710） Troponin T2, cardiac type × 1 （A0A5G2Q8N0） ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TPM1_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–284； UniProt 1–284 Author chain G； PDBConstruct 1–284； UniProt 1–284

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8v01
Deposition date deposition_date	2023-11-16
Structure title title	The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand
Keywords keywords	thin filament, troponin, tropomyosin, cryo-EM, muscle structure, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8v01__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8v01__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8v01__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	39.47 Å
Rg (electron density)	39.14 Å
Total Rg	39.49 Å
Atom count	10177
Residues	1274
Excluded volume	180610 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8v01__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Actin, alpha cardiac muscle 1
Molecular weight formula_weight	42064.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	10177

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Entity 2 Entity 2 polymer

Description description	Troponin C, slow skeletal and cardiac muscles
Molecular weight formula_weight	18433.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Entity 3 Entity 3 polymer

Description description	Troponin I, cardiac muscle
Molecular weight formula_weight	24092.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MADRSGDAAGDSRPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLSFAELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLNQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKETLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFEG

Entity 4 Entity 4 polymer

Description description	Troponin T2, cardiac type
Molecular weight formula_weight	33941.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSDVEETVDEYEEEQEEGAAEEQEEAVEEEAGGEAEAEEANAEEAGQEEDGREAEDGPMEESKPKPRLFMPNLVPPKIPDGERVDFDDIHRKRMKDLNELQTLIEAHFENRKKEEELVSLKDRIEKRRAERAEQQRIRTEREKERQTRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Entity 5 Entity 5 polymer

Description description	Tropomyosin alpha-1 chain
Molecular weight formula_weight	32762.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKYSEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	5.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	58709

The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

State in the Current Structure

Other States of the Same Protein in the Database

Troponin C, slow skeletal and cardiac muscles

State in the Current Structure

Other States of the Same Protein in the Database

Troponin I, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Troponin T2, cardiac type

State in the Current Structure

Other States of the Same Protein in the Database

Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8v01__assembly_1__model_1

8v01__assembly_1__model_1 | I(q)

8v01__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)

The structure of the native cardiac thin filament troponin core in Ca2+-bound fully activated state 1 from the lower strand

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Troponin C, slow skeletal and cardiac muscles

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Troponin I, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Troponin T2, cardiac type

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8v01__assembly_1__model_1

8v01__assembly_1__model_1 | I(q)

8v01__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)