9c7v

Structure of the human BOS:human EMC complex in GDN

Method: ELECTRON MICROSCOPY D_max: 215.7 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ER membrane protein complex subunit 10

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 10； UniProt 1–262	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 1–262（262 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 2–262（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain I 2–262（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 50–206（157 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain J 1–207（207 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain J 1–207（207 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 10 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC10_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 10； PDBConstruct 1–262； UniProt 1–262

ER membrane protein complex subunit 1

OrganismNot specified

UniProt Q8N766

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 1； UniProt 1–993	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 482–510（29 aa） Chain A 960–993（34 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 21–993（973 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–993（993 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–993（993 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–993； UniProt 1–993

ER membrane protein complex subunit 2

Homo sapiens

UniProt Q15006

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 2； UniProt 1–297	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Y4L Crystal structure of human ER membrane protein complex subunits EMC2 and EMC9 Deposited 2020-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–274（264 aa）	Not recorded	SO4 SULFATE ION × 3 EDO 1,2-ETHANEDIOL × 3 PE4 2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL × 1 PEG DI(HYDROXYETHYL)ETHER × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；293.15 K；34% PEG4000, 0.1 M Tris pH 8.3, and 0.2 M lithium sulfate (For I03 native dataset) X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；293.15 K；28% PEG4000, 0.1 M Tris pH 8.3, and 0.2 M lithium sulfate (For I23 S-SAD dataset)	Resolution 2.20 Å R-free 0.250
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 3–293（291 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 2 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–297； UniProt 1–297

ER membrane protein complex subunit 3

OrganismNot specified

UniProt Q9P0I2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 3； UniProt 1–261	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 4–261（258 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 3 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–261； UniProt 1–261

ER membrane protein complex subunit 4

OrganismNot specified

UniProt Q5J8M3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 4； UniProt 1–183	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–183（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain D 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 14–183（170 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–183（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–183（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 4 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 4； PDBConstruct 1–183； UniProt 1–183

Membrane magnesium transporter 1

OrganismNot specified

UniProt Q8N4V1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 5； UniProt 66–196	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–131（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–131（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 3–103（101 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 5 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MMGT1_HUMAN
Isoform	Q8N4V1-2
PDB entities	6
Chains and sequence ranges	Author chain 5； PDBConstruct 1–131； UniProt 66–196

ER membrane protein complex subunit 6

OrganismNot specified

UniProt Q9BV81

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 6； UniProt 1–110	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain F 11–110（100 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 6 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain 6； PDBConstruct 1–110； UniProt 1–110

ER membrane protein complex subunit 7

OrganismNot specified

UniProt Q9NPA0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 7； UniProt 1–242	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2UWE Large CDR3a loop alteration as a function of MHC mutation Deposited 2007-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 4–12（9 aa） Fragment：RESIDUES 4-12	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；14% PEG 8000, 1 M NACL, 25 MM HEPES, PH 7.8	Resolution 2.40 Å R-free 0.290
2UWE Large CDR3a loop alteration as a function of MHC mutation Deposited 2007-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 4–12（9 aa） Fragment：RESIDUES 4-12	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；14% PEG 8000, 1 M NACL, 25 MM HEPES, PH 7.8	Resolution 2.40 Å R-free 0.290
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–242（242 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 43–158（116 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–242（242 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–242（242 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 7 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 7； PDBConstruct 1–242； UniProt 1–242

ER membrane protein complex subunit 8

OrganismNot specified

UniProt O43402

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain 8； UniProt 1–210	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 3–210（208 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–210（210 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8J0O cryo-EM structure of human EMC and VDAC Deposited 2023-04-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain H 1–210（210 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 8 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC8_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 8； PDBConstruct 1–210； UniProt 1–210

Nicalin

OrganismNot specified

UniProt Q969V3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 1–563	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） BOS complex subunit NOMO2 × 1 （Q5JPE7） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6W6L Cryo-EM structure of the human ribosome-TMCO1 translocon Deposited 2020-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 54-meric	Chain 5 1–563（563 aa）	Not recorded	MG MAGNESIUM ION × 28 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Two filter papers were added to each arm, 2.5 microliters of sample were added to the grids, and 0.5 seconds of drain time was allowed before vitrification.	Resolution 3.84 Å
9C7U Structure of the human truncated BOS complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–563（563 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NCLN_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain A； PDBConstruct 1–563； UniProt 1–563

BOS complex subunit NOMO2

OrganismNot specified

UniProt Q5JPE7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 1–1267	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） Transmembrane protein 147 × 1 （Q9BVK8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9C7U Structure of the human truncated BOS complex in GDN Deposited 2024-06-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–36（36 aa） Fragment：UNP residues 1-36,873-1222 (Ig domains 1-9 deleted) Chain B 873–1222（350 aa） Fragment：UNP residues 1-36,873-1222 (Ig domains 1-9 deleted)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NOMO2_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B； PDBConstruct 1–1267； UniProt 1–1267

Transmembrane protein 147

Homo sapiens

UniProt Q9BVK8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 2 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain C； UniProt 1–224	Not recorded	ER membrane protein complex subunit 10 × 1 （Q5UCC4） ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Nicalin × 1 （Q969V3） BOS complex subunit NOMO2 × 1 （Q5JPE7） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.60 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9C7V	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6W6L Cryo-EM structure of the human ribosome-TMCO1 translocon Deposited 2020-03-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 49 PDB declaration: 54-meric	Chain 4 1–224（224 aa）	Not recorded	MG MAGNESIUM ION × 28 ZN ZINC ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Two filter papers were added to each arm, 2.5 microliters of sample were added to the grids, and 0.5 seconds of drain time was allowed before vitrification.	Resolution 3.84 Å
9C7U Structure of the human truncated BOS complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–224（224 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TM147_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain C； PDBConstruct 1–224； UniProt 1–224

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9c7v
Deposition date deposition_date	2024-06-11
Structure title title	Structure of the human BOS:human EMC complex in GDN
Keywords keywords	membrane protein biogenesis, membrane protein complex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	60.70 Å
Radius of gyration Rg (electron density) rg_electron	60.55 Å
Forward intensity I(0) i0	1675240000.00
Molecular weight molecular_weight	347600.0 kDa
Excluded volume excluded_volume	436670 Å³
Envelope volume envelope_volume	663230 Å³
Hydration-shell volume shell_volume	95591 Å³
Envelope diameter envelope_diameter	216.2 Å
Shell Rg shell_rg	58.29 Å
Envelope Rg envelope_rg	58.39 Å
Shape Rg shape_rg	60.54 Å
Total Rg total_rg	60.52 Å
Total atoms total_atoms	24532
Residues n_residues	3144
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	215.7 Å
Rg (real space) rg_real	60.94 Å
Rg uncertainty (real space) rg_real_error	2.34 Å
I(0) (real space) i0_real	1.6750e+09
I(0) uncertainty (real space) i0_real_error	3.5690e+07
Rg (reciprocal space) rg_reciprocal	60.45 Å
I(0) (reciprocal space) i0_reciprocal	1674000000.0000
Solution quality estimate total_estimate	0.8657
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	66.4 Å
Skewness Skewness skewness	0.365
Kurtosis Kurtosis kurtosis	-0.495
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	84990000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.824; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.782

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	ER membrane protein complex subunit 10
Molecular weight formula_weight	27375.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	10
Atom count atom_count	24532

MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDTGGQGGGGGGGGGGGSGR

Entity 2 Entity 2 polymer

Description description	ER membrane protein complex subunit 1
Molecular weight formula_weight	111886.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSEDGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR

Entity 3 Entity 3 polymer

Description description	ER membrane protein complex subunit 2
Molecular weight formula_weight	34882.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	ER membrane protein complex subunit 3
Molecular weight formula_weight	29981.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

Entity 5 Entity 5 polymer

Description description	ER membrane protein complex subunit 4
Molecular weight formula_weight	20104.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL

Entity 6 Entity 6 polymer

Description description	Membrane magnesium transporter 1
Molecular weight formula_weight	14706.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

Entity 7 Entity 7 polymer

Description description	ER membrane protein complex subunit 6
Molecular weight formula_weight	12029.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Entity 8 Entity 8 polymer

Description description	ER membrane protein complex subunit 7
Molecular weight formula_weight	26501.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR

Entity 9 Entity 9 polymer

Description description	ER membrane protein complex subunit 8
Molecular weight formula_weight	23807.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Entity 10 Entity 10 polymer

Description description	Nicalin
Molecular weight formula_weight	63047.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MLEEAGEVLENMLKASCLPLGFIVFLPAVLLLVAPPLPAADAAHEFTVYRMQQYDLQGQPYGTRNAVLNTEARTMAAEVLSRRCVLMRLLDFSYEQYQKALRQSAGAVVIILPRAMAAVPQDVVRQFMEIEPEMLAMETAVPVYFAVEDEALLSIYKQTQAASASQGSASAAEVLLRTATANGFQMVTSGVQSKAVSDWLIASVEGRLTGLGGEDLPTIVIVAHYDAFGVAPWLSLGADSNGSGVSVLLELARLFSRLYTYKRTHAAYNLLFFASGGGKFNYQGTKRWLEDNLDHTDSSLLQDNVAFVLCLDTVGRGSSLHLHVSKPPREGTLQHAFLRELETVAAHQFPEVRFSMVHKRINLAEDVLAWEHERFAIRRLPAFTLSHLESHRDGQRSSIMDVRSRVDSKTLTRNTRIIAEALTRVIYNLTEKGTPPDMPVFTEQMQIQQEQLDSVMDWLTNQPRAAQLVDKDSTFLSTLEHHLSRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYLGMAYVAVQHFSLLYKTVQRLLVKAKTQ

Entity 11 Entity 11 polymer

Description description	BOS complex subunit NOMO2
Molecular weight formula_weight	139580.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLVGQGAGLLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIVATGFSVCGRISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAITLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQEREKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVGALGQAASDNSGPEDAKRQAKKQKTRRTLRLQEEFQLMWCLVPWRGTLGIHLFSSLPFASEILLETTATCIHY

Entity 12 Entity 12 polymer

Description description	Transmembrane protein 147
Molecular weight formula_weight	25279.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGIEFDWKYIQMSIDSNISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWAALLARAVVTGLLALSTLALYVAVVNVHS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 13 Entity 13 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	6.60 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	45703

fit	/app/data/saxs_computation/c7/9c7v/9c7v.fit
pddf	/app/data/pr_computation/c7/9c7v/9c7v.pr.out
profile	/app/data/saxs_computation/c7/9c7v/9c7v.dat

Structure of the human BOS:human EMC complex in GDN

1. Protein Identity and Related Structures Protein Identity & Related Structures

ER membrane protein complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Membrane magnesium transporter 1

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Nicalin

State in the Current Structure

Other States of the Same Protein in the Database

BOS complex subunit NOMO2

State in the Current Structure

Other States of the Same Protein in the Database

Transmembrane protein 147

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

来源 Source

Entity 13 Entity 13 branched

Entity 14 Entity 14 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)