7ado

Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ER membrane protein complex subunit 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–993； UniProt 1–993

ER membrane protein complex subunit 2

Homo sapiens

UniProt Q15006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–297； UniProt 1–297

ER membrane protein complex subunit 3

Homo sapiens

UniProt Q9P0I2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–261； UniProt 1–261

ER membrane protein complex subunit 4

Homo sapiens

UniProt Q5J8M3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–183； UniProt 1–183

Membrane magnesium transporter 1

Homo sapiens

UniProt Q8N4V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MMGT1_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–131； UniProt 1–131

ER membrane protein complex subunit 6

Homo sapiens

UniProt Q9BV81

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–110； UniProt 1–110

ER membrane protein complex subunit 7

Homo sapiens

UniProt Q9NPA0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–242； UniProt 1–242

ER membrane protein complex subunit 8

Homo sapiens

UniProt O43402

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–210； UniProt 1–210

ER membrane protein complex subunit 10

Homo sapiens

UniProt Q5UCC4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 10	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） Membrane magnesium transporter 1 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Unassigned helix × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMC10_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 3–263； UniProt 2–262

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ado
Deposition date deposition_date	2020-09-15
Structure title title	Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs
Keywords keywords	ER membrane protein, EMC, Membrane protein biogenesis, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ado__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ado__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ado__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.07 Å
Rg (electron density)	59.44 Å
Total Rg	59.15 Å
Atom count	16837
Residues	2085
Excluded volume	301740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ado__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	ER membrane protein complex subunit 1
Molecular weight formula_weight	111886.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	16845

MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSEDGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	ER membrane protein complex subunit 2
Molecular weight formula_weight	34882.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	ER membrane protein complex subunit 3
Molecular weight formula_weight	29981.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	ER membrane protein complex subunit 4
Molecular weight formula_weight	20104.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Membrane magnesium transporter 1
Molecular weight formula_weight	15703.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRRDYKDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	ER membrane protein complex subunit 6
Molecular weight formula_weight	12029.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	ER membrane protein complex subunit 7
Molecular weight formula_weight	26501.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	ER membrane protein complex subunit 8
Molecular weight formula_weight	23807.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	ER membrane protein complex subunit 10
Molecular weight formula_weight	27446.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDTGGQGGGGGGGGGGGSGR

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	Unassigned helix
Molecular weight formula_weight	1379.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

XXXXXXXXXXXXXXXX

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 11 Entity 11 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 12 Entity 12 non-polymer

Description description	1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	787.1 kDa
Source method src_method	syn
Copy count entity_count	5

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.39 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	177560

Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs

1. Protein Identity and Related Structures Protein Identity & Related Structures

ER membrane protein complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Membrane magnesium transporter 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ER membrane protein complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ado__assembly_1__model_1

7ado__assembly_1__model_1 | I(q)

7ado__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment