8j0o

cryo-EM structure of human EMC and VDAC

Method: ELECTRON MICROSCOPY D_max: 194.4 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ER membrane protein complex subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain A； UniProt 1–993	Not recorded	ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 482–510（29 aa） Chain A 960–993（34 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 21–993（973 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–993（993 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 1 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 1 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 1–993（993 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–993； UniProt 1–993

ER membrane protein complex subunit 2

OrganismNot specified

UniProt Q15006

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain B； UniProt 1–297	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Y4L Crystal structure of human ER membrane protein complex subunits EMC2 and EMC9 Deposited 2020-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 11–274（264 aa）	Not recorded	SO4 SULFATE ION × 3 EDO 1,2-ETHANEDIOL × 3 PE4 2-{2-[2-(2-{2-[2-(2-ETHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-ETHOXY]-ETHOXY}-ETHANOL × 1 PEG DI(HYDROXYETHYL)ETHER × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；293.15 K；34% PEG4000, 0.1 M Tris pH 8.3, and 0.2 M lithium sulfate (For I03 native dataset) X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；293.15 K；28% PEG4000, 0.1 M Tris pH 8.3, and 0.2 M lithium sulfate (For I23 S-SAD dataset)	Resolution 2.20 Å R-free 0.250
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 3–293（291 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–297（297 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 2 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 2 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 1–297（297 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–297； UniProt 1–297

ER membrane protein complex subunit 3

OrganismNot specified

UniProt Q9P0I2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain C； UniProt 1–261	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 4–261（258 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–261（261 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 3 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 3 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 1–261（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–261； UniProt 1–261

ER membrane protein complex subunit 4

OrganismNot specified

UniProt Q5J8M3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain D； UniProt 1–183	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–183（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain D 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 14–183（170 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–183（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 4 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 4 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 1–183（183 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–183； UniProt 1–183

ER membrane protein complex subunit 5

OrganismNot specified

UniProt Q8N4V1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain E； UniProt 1–131	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–131（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–131（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 3–103（101 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 5 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 5 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 66–196（131 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–131； UniProt 1–131

ER membrane protein complex subunit 6

OrganismNot specified

UniProt Q9BV81

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain F； UniProt 1–110	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain F 11–110（100 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 6 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 6 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain F 1–110（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–110； UniProt 1–110

ER membrane protein complex subunit 7

OrganismNot specified

UniProt Q9NPA0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain G； UniProt 1–242	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2UWE Large CDR3a loop alteration as a function of MHC mutation Deposited 2007-03-20	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 4–12（9 aa） Fragment：RESIDUES 4-12	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；14% PEG 8000, 1 M NACL, 25 MM HEPES, PH 7.8	Resolution 2.40 Å R-free 0.290
2UWE Large CDR3a loop alteration as a function of MHC mutation Deposited 2007-03-20	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 4–12（9 aa） Fragment：RESIDUES 4-12	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；14% PEG 8000, 1 M NACL, 25 MM HEPES, PH 7.8	Resolution 2.40 Å R-free 0.290
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–242（242 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 43–158（116 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–242（242 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 7 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 7 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 1–242（242 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–242； UniProt 1–242

ER membrane protein complex subunit 8

OrganismNot specified

UniProt O43402

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain H； UniProt 1–210	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 10 × 1 （Q5UCC4） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 3–210（208 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–210（210 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 8 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 8 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 1–210（210 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–210； UniProt 1–210

ER membrane protein complex subunit 10

OrganismNot specified

UniProt Q5UCC4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain J； UniProt 1–207	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） Voltage-dependent anion-selective channel protein 1 × 1 （P21796） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6WW7 Structure of the human ER membrane protein complex in a lipid nanodisc Deposited 2020-05-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6Z3W Human ER membrane protein complex Deposited 2020-05-22	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain I 1–262（262 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.40 Å
7ADO Cryo-EM structure of human ER membrane protein complex in lipid nanodiscs Deposited 2020-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 2–262（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.39 Å
7ADP Cryo-EM structure of human ER membrane protein complex in GDN detergent Deposited 2020-09-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain I 2–262（261 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6；10 mM ammonium citrate pH 6.0, 100 mM sodium chloride, 0.25 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 50–206（157 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8J0N cryo-EM structure of human EMC Deposited 2023-04-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain J 1–207（207 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8S9S Structure of the human ER membrane protein complex (EMC) in GDN Deposited 2023-03-30	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain 10 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PCW 1,2-DIOLEOYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9C7V Structure of the human BOS:human EMC complex in GDN Deposited 2024-06-11	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain 10 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.60 Å
9ZZ6 The ER membrane protein complex acts as a chaperone to promote voltage-gated calcium channel assembly Deposited 2026-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 1–262（262 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 adjusted with KOH ( potassium hydroxide). cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EMC10_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–207； UniProt 1–207

Voltage-dependent anion-selective channel protein 1

OrganismNot specified

UniProt P21796

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 10 其他Polymer 3 PDB declaration: decameric（10） Consistent with protein copy count	Chain K； UniProt 1–283	Not recorded	ER membrane protein complex subunit 1 × 1 （Q8N766） ER membrane protein complex subunit 2 × 1 （Q15006） ER membrane protein complex subunit 3 × 1 （Q9P0I2） ER membrane protein complex subunit 4 × 1 （Q5J8M3） ER membrane protein complex subunit 5 × 1 （Q8N4V1） ER membrane protein complex subunit 6 × 1 （Q9BV81） ER membrane protein complex subunit 7 × 1 （Q9NPA0） ER membrane protein complex subunit 8 × 1 （O43402） ER membrane protein complex subunit 10 × 1 （Q5UCC4） beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.32 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8J0O	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2JK4 Structure of the human voltage-dependent anion channel Deposited 2008-08-15	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–283（282 aa） Fragment：RESIDUES 2-283	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2 M MAGNESIUM CHLORIDE HEXAHYDRATE, 0.1 M HEPES SODIUM PH 7.5, 30% V/V POLYETHYLENE GLYCOL 400	Resolution 4.10 Å R-free 0.387
2K4T Solution structure of human VDAC-1 in LDAO micelles Deposited 2008-06-17	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–283（283 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；303 K；Ionic strength (raw mmCIF value) 25；Pressure AMBIENT NMR sample composition 1 mM [U-13C; U-15N; U-2H] VDAC-1, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
5JDP E73V mutant of the human voltage-dependent anion channel Deposited 2016-04-17	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–283（282 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；310 K；Ionic strength (raw mmCIF value) 20；Pressure 1 NMR sample composition 0.8 mM U- 2H, 15N_sample E73V mutant of the Voltage-dependent anion channel 1, 2 % [U-2H] LDAO, 20 mM [U-2H] TRIS, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5XDN Crystal structure of human voltage-dependent anion channel 1 (hVDAC1) in P22121 space group Deposited 2017-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–283（283 aa） Chain B 1–283（283 aa）	Not recorded	D12 DODECANE × 2 HEX HEXANE × 4 OCT N-OCTANE × 1 D10 DECANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；36% PEG300, 0.1 M MES (pH 6.5), 0.1 M NaCl	Resolution 3.15 Å R-free 0.300
5XDO Crystal structure of human voltage-dependent anion channel 1 (hVDAC1) in C222 space group Deposited 2017-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–283（283 aa） Chain B 1–283（283 aa）	Not recorded	SPD SPERMIDINE × 2 OCT N-OCTANE × 4 LNK PENTANE × 2 HEX HEXANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；45% PEG300, 0.1 M HEPES (pH 7.0), 0.15 M NaCl, 11 mM spermidine	Resolution 3.10 Å R-free 0.298
6G6U The dynamic nature of the VDAC1 channels in bilayers: human VDAC1 at 2.7 Angstrom resolution Deposited 2018-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–283（283 aa） Chain B 1–283（283 aa）	Not recorded	MC3 1,2-DIMYRISTOYL-RAC-GLYCERO-3-PHOSPHOCHOLINE × 3 NO3 NITRATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；25.5% precipitant mix 4 [25% (v/v) MPD, 25% (w/v) PEG 1000, 25% (w/v) PEG 3350], 0.06 M NH4NO3, 0.1 buffer system 1 [imidazole and MES adjusted to pH 6.5]	Resolution 2.74 Å R-free 0.287
6G73 The dynamic nature of the VDAC1 channels in bilayers: human VDAC1 at 3.3 Angstrom resolution Deposited 2018-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–283（283 aa） Chain D 1–283（283 aa）	Not recorded	MC3 1,2-DIMYRISTOYL-RAC-GLYCERO-3-PHOSPHOCHOLINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；292.2 K；25.5% Precipitant mix 4 [precipitant mix 4 consists of 25% (v/v) MPD, 25% (w/v) PEG1000, 25% (w/v) PEG3350], 0.06M NaNO3, 0.08M K2HPO4, 0.1M Buffer System2 [HEPES and MOPS adjusted to pH 7.5]	Resolution 3.27 Å R-free 0.298
6G73 The dynamic nature of the VDAC1 channels in bilayers: human VDAC1 at 3.3 Angstrom resolution Deposited 2018-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–283（283 aa） Chain B 1–283（283 aa）	Not recorded	MC3 1,2-DIMYRISTOYL-RAC-GLYCERO-3-PHOSPHOCHOLINE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；292.2 K；25.5% Precipitant mix 4 [precipitant mix 4 consists of 25% (v/v) MPD, 25% (w/v) PEG1000, 25% (w/v) PEG3350], 0.06M NaNO3, 0.08M K2HPO4, 0.1M Buffer System2 [HEPES and MOPS adjusted to pH 7.5]	Resolution 3.27 Å R-free 0.298
6TIQ Refined solution NMR structure of hVDAC-1 in detergent micelles Deposited 2019-11-22	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–283（283 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303.15 K；Ionic strength (raw mmCIF value) 225；Pressure 1 NMR sample composition 0.6 mM U-99%-2H,13C,15N hVDAC-1, 3 % no LDAO, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.6 mM [ U -99%- 2 H, 13 C, 15 N; 99%- 1 H delta -IL; 99%- 1 H gamma -V] hVDAC-1, 3 % [U-99% 2H] LDAO, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.6 mM [ U -99%- 2 H, 15 N; 99%- 1 H delta , 13 C delta -IL; 99%- 1 H gamma , 13 C gamma -V] hVDAC-1, 3 % [U-99% 2H] LDAO, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6TIR NOE based model of hVDAC-1 bound to beta-NADH in detergent micelles Deposited 2019-11-22	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–283（283 aa）	Not recorded	NAI 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1	SOLUTION NMR NMR measurement conditions pH 6.5；303.15 K；Ionic strength (raw mmCIF value) 25；Pressure 1 NMR sample composition 0.5 mM [U-99%-2H, 15N; 99%-1Hdelta-IL; 99%-1Hgamma-V] human VDAC-1, 45 mM beta-NADH, 150 mM [U-99% 2H] LDAO, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-99%-2H, 15N; 99%-1H,13C-delta-IL; 99%-1H,13Cgamma-V] human VDAC-1, 45 mM beta-NADH, 150 mM [U-99% 2H] LDAO, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM U-99%-2H,15N,13C human VDAC-1, 150 mM [U-99% 2H] LDAO, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
7QI2 Magic-angle spinning NMR structure of the human voltage-dependent anion channel 1 (E73V/C127A/C232S) in DMPC lipid bilayers Deposited 2021-12-14	Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–283（283 aa）	Mutation：E73V/C127A/C232S	No recorded non-water small molecule	SOLID-STATE NMR NMR measurement conditions pH 6.5；285 K；Ionic strength (raw mmCIF value) 0.21；Pressure 1 NMR sample composition 66 % w/w [U-13C; U-15N; U-2H] u[2H,13C,15N]-hVDAC1(E73V/C127A/C232S), 33 % w/w DMPC, 10 mM MES, 150 mM sodium chloride, 20 mM MgCl2, 100% H2O \| 100% H2O NMR sample composition 66 % w/w [U-13C; U-15N]-alpha PET u[2H,13C,15N]-hVDAC1(E73V/C127A/C232S), 33 % w/w DMPC, 10 mM MES, 150 mM sodium chloride, 20 mM MgCl2, 100% H2O \| 100% H2O	Resolution not provided
9PFZ Architecture of human Voltage Dependent Anion Channel 1 in nanodiscs Deposited 2025-07-07	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–283（283 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7；25 mM NaPi, 100 mM NaCl, pH 7.0 cryo-EM vitrification conditions Cryogen ETHANE；3.0 uL sample, blot time 3sec, Blotforce 1, Blot total 1,	Resolution 5.40 Å

11 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VDAC1_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–283； UniProt 1–283

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8j0o
Deposition date deposition_date	2023-04-11
Structure title title	cryo-EM structure of human EMC and VDAC
Keywords keywords	ER membrane protein complex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	58.86 Å
Radius of gyration Rg (electron density) rg_electron	58.95 Å
Forward intensity I(0) i0	1216370000.00
Molecular weight molecular_weight	297880.0 kDa
Excluded volume excluded_volume	375670 Å³
Envelope volume envelope_volume	603070 Å³
Hydration-shell volume shell_volume	90635 Å³
Envelope diameter envelope_diameter	211.4 Å
Shell Rg shell_rg	55.83 Å
Envelope Rg envelope_rg	57.09 Å
Shape Rg shape_rg	58.99 Å
Total Rg total_rg	58.73 Å
Total atoms total_atoms	20986
Residues n_residues	2627
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	194.4 Å
Rg (real space) rg_real	59.29 Å
Rg uncertainty (real space) rg_real_error	1.89 Å
I(0) (real space) i0_real	1.2160e+09
I(0) uncertainty (real space) i0_real_error	2.2840e+07
Rg (reciprocal space) rg_reciprocal	58.47 Å
I(0) (reciprocal space) i0_reciprocal	1215000000.0000
Solution quality estimate total_estimate	0.5961
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	50.4 Å
Skewness Skewness skewness	0.467
Kurtosis Kurtosis kurtosis	-0.426
Angular range angular_range	— – 0.1350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	157000000.0000
Real-space data points n_real_points	28
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.873; Stabil: 1.000; Sysdev: 0.009; Positv: 1.000; Valcen: 0.913; Smooth: 0.184

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	ER membrane protein complex subunit 1
Molecular weight formula_weight	111886.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	20986

MAAEWASRFWLWATLLIPAAAVYEDQVGKFDWRQQYVGKVKFASLEFSPGSKKLVVATEKNVIAALNSRTGEILWRHVDKGTAEGAVDAMLLHGQDVITVSNGGRIMRSWETNIGGLNWEITLDSGSFQALGLVGLQESVRYIAVLKKTTLALHHLSSGHLKWVEHLPESDSIHYQMVYSYGSGVVWALGVVPFSHVNIVKFNVEDGEIVQQVRVSTPWLQHLSGACGVVDEAVLVCPDPSSRSLQTLALETEWELRQIPLQSLDLEFGSGFQPRVLPTQPNPVDASRAQFFLHLSPSHYALLQYHYGTLSLLKNFPQTALVSFATTGEKTVAAVMACRNEVQKSSSSEDGSMGSFSEKSSSKDSLACFNQTYTINLYLVETGRRLLDTTITFSLEQSGTRPERLYIQVFLKKDDSVGYRALVQTEDHLLLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADGLLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVMVTASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKESGMSSLYVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLIDDEYKVTAFPATRNVLRQLHELAPSIFFYLVDAEQGRLCGYRLRKDLTTELSWELTIPPEVQRIVKVKGKRSSEHVHSQGRVMGDRSVLYKSLNPNLLAVVTESTDAHHERTFIGIFLIDGVTGRIIHSSVQKKAKGPVHIVHSENWVVYQYWNTKARRNEFTVLELYEGTEQYNATAFSSLDRPQLPQVLQQSYIFPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR

Entity 2 Entity 2 polymer

Description description	ER membrane protein complex subunit 2
Molecular weight formula_weight	34882.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS

Entity 3 Entity 3 polymer

Description description	ER membrane protein complex subunit 3
Molecular weight formula_weight	29981.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

Entity 4 Entity 4 polymer

Description description	ER membrane protein complex subunit 4
Molecular weight formula_weight	20104.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL

Entity 5 Entity 5 polymer

Description description	ER membrane protein complex subunit 5
Molecular weight formula_weight	14706.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

Entity 6 Entity 6 polymer

Description description	ER membrane protein complex subunit 6
Molecular weight formula_weight	12029.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY

Entity 7 Entity 7 polymer

Description description	ER membrane protein complex subunit 7
Molecular weight formula_weight	26501.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR

Entity 8 Entity 8 polymer

Description description	ER membrane protein complex subunit 8
Molecular weight formula_weight	23807.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

Entity 9 Entity 9 polymer

Description description	ER membrane protein complex subunit 10
Molecular weight formula_weight	21781.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEM

Entity 10 Entity 10 polymer

Description description	Voltage-dependent anion-selective channel protein 1
Molecular weight formula_weight	30807.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Entity 11 Entity 11 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	3

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.32 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	455504

fit	/app/data/saxs_computation/j0/8j0o/8j0o.fit
pddf	/app/data/pr_computation/j0/8j0o/8j0o.pr.out
profile	/app/data/saxs_computation/j0/8j0o/8j0o.dat

cryo-EM structure of human EMC and VDAC

1. Protein Identity and Related Structures Protein Identity & Related Structures

ER membrane protein complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

ER membrane protein complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Voltage-dependent anion-selective channel protein 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 branched

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)