9e2x

Cryo-EM structure of yeast CMG helicase stalled at G4-containing DNA template, state 2

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication complex GINS protein PSF1

Saccharomyces cerevisiae W303

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSF1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–208； UniProt 1–208

DNA replication complex GINS protein PSF2

Saccharomyces cerevisiae W303

UniProt P40359

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSF2_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–213； UniProt 1–213

DNA replication complex GINS protein PSF3

Saccharomyces cerevisiae W303

UniProt Q12146

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSF3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 24–217； UniProt 1–194

DNA replication complex GINS protein SLD5

Saccharomyces cerevisiae W303

UniProt Q03406

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SLD5_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–294； UniProt 1–294

Cell division control protein 45

Saccharomyces cerevisiae W303

UniProt Q08032

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC45_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–650； UniProt 1–650

DNA replication licensing factor MCM2

Saccharomyces cerevisiae W303

UniProt P29469

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM2_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 2； PDBConstruct 1–868； UniProt 1–868

DNA replication licensing factor MCM3

Saccharomyces cerevisiae W303

UniProt P24279

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM3_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 3； PDBConstruct 1–971； UniProt 1–971

DNA replication licensing factor MCM4

Saccharomyces cerevisiae W303

UniProt P30665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM4_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 4； PDBConstruct 1–933； UniProt 1–933

Minichromosome maintenance protein 5

Saccharomyces cerevisiae W303

UniProt P29496

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM5_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 5； PDBConstruct 1–775； UniProt 1–775

DNA replication licensing factor MCM6

Saccharomyces cerevisiae W303

UniProt P53091

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM6_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 6； PDBConstruct 1–1017； UniProt 1–1017

DNA replication licensing factor MCM7

Saccharomyces cerevisiae W303

UniProt P38132

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） Topoisomerase 1-associated factor 1 × 1 （P53840） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM7_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 7； PDBConstruct 1–845； UniProt 1–845

Topoisomerase 1-associated factor 1

Saccharomyces cerevisiae W303

UniProt P53840

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Chromosome segregation in meiosis protein 3 × 1 （Q04659） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOF1_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain X； PDBConstruct 1–1238； UniProt 1–1238

Chromosome segregation in meiosis protein 3

Saccharomyces cerevisiae W303

UniProt Q04659

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 13 DNA 2	DNA replication complex GINS protein PSF1 × 1 （Q12488） DNA replication complex GINS protein PSF2 × 1 （P40359） DNA replication complex GINS protein PSF3 × 1 （Q12146） DNA replication complex GINS protein SLD5 × 1 （Q03406） Cell division control protein 45 × 1 （Q08032） Leading strand DNA template × 1 Lagging strand DNA template × 1 DNA replication licensing factor MCM2 × 1 （P29469） DNA replication licensing factor MCM3 × 1 （P24279） DNA replication licensing factor MCM4 × 1 （P30665） Minichromosome maintenance protein 5 × 1 （P29496） DNA replication licensing factor MCM6 × 1 （P53091） DNA replication licensing factor MCM7 × 1 （P38132） Topoisomerase 1-associated factor 1 × 1 （P53840） ADENOSINE-5'-TRIPHOSPHATE × 4 MAGNESIUM ION × 5 ZINC ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSM3_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Y； PDBConstruct 1–92； UniProt 48–139

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9e2x
Deposition date deposition_date	2024-10-23
Structure title title	Cryo-EM structure of yeast CMG helicase stalled at G4-containing DNA template, state 2
Keywords keywords	helicase, DNA replication, cell division, fork stalling, translocation, REPLICATION, REPLICATION-DNA complex; REPLICATION/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9e2x__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9e2x__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9e2x__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.96 Å
Rg (electron density)	61.97 Å
Total Rg	61.95 Å
Atom count	98329
Residues	6044
Excluded volume	877560 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9e2x__assembly_1__model_1`	15-meric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	DNA replication complex GINS protein PSF1
Molecular weight formula_weight	24230.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	98329

MYGDLGNKLVLEAKRTKQLYARSNQDVNLPMYHEDIIRNILKEVSNLRKNTEYLKEQQQLGMLDDKVAKCQYFVTLLCMERNKRCLLAYQRLRTDILDSMAWNNNGLDLMSSITFSQQDTNNLSHQEQEYLKEYCDLITDLKSGDLVDIDLSGSLVPPSDVFIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRQSDVERLIQQGYLQKI

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 2 Entity 2 polymer

Description description	DNA replication complex GINS protein PSF2
Molecular weight formula_weight	25096.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSLPAHLQQTFSPEEIQFIVENEPIKIFPRITTRQKIRGDDRGTGNHTRWQLITTDDKALNNMVAMRSTEVVLWIALLLKQQSKCSIVAPQWLTTKELDRKIQYEKTHPDRFSELPWNWLVLARILFNKAKDDFHDPIHELRGKIQDLREIRQIKVLKGLKYLNESHLQLDNLSLLEINELRPFITEIMDKLREIHTASLTAGTENDEEEFNI

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 3 Entity 3 polymer

Description description	DNA replication complex GINS protein PSF3
Molecular weight formula_weight	24437.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MGSSHHHHHHSSGLVPRGSHMASMGYYDIDDVLADGTEFPCKFQYDIPGLGYLENNPGRPITKNTKLSLPLWLARILAIVGGDEALVDEEPVPFVELLPPDMFSTKVMNAIKTDPVALDLHSINSHFFSLAIKWIMLFSEKELANVVSELLLQRAQELNHHASSLSIDLNADSTGKNSANTNIATSTFLLKLEEMEKEIYKKSHESYKDTKRWMFKK

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 4 Entity 4 polymer

Description description	DNA replication complex GINS protein SLD5
Molecular weight formula_weight	33983.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MDINIDDILAELDKETTAVDSTKITQGSSSTTHRDANTIVGSSLDLNDKTQIYVSPQQDFSDLMKSWKNERCSPELLPYPHQLMKRLLNRISMQSQLIENISMGFLDMQNASNANPPMPNESKLPLLCMETELERLKFVIRSYIRCRLSKIDKFSLYLRQLNEDENSLISLTDLLSKDEIKYHDTHSLIWLKLVNDSILKYMPEELQAINDTEGSVNMIDEPDWNKFVFIHVNGPPDGKWNEDPLLQENEFGKPCYTVTIPDLKEEVELTIGSIYVMRYEVIRDLLRDDKVALI

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 5 Entity 5 polymer

Description description	Cell division control protein 45
Molecular weight formula_weight	74324.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDENDNNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEYYSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVKRLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLSWDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYRNPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKPILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 6 Entity 6 polymer

Description description	Leading strand DNA template
Molecular weight formula_weight	15060.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F

TCGTGCTGAGTGATATCTGCTTTGGGTGGGTGGGTGGGTTGAGGCAAT

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 7 Entity 7 polymer

Description description	Lagging strand DNA template
Molecular weight formula_weight	6112.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	G

GCAGATATCACTCAGCACGA

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 8 Entity 8 polymer

Description description	DNA replication licensing factor MCM2
Molecular weight formula_weight	98911.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MSDNRRRRREEDDSDSENELPPSSPQQHFRGGMNPVSSPIGSPDMINPEGDDNEVDDVPDIDEVEEQMNEVDLMDDNMYEDYAADHNRDRYDPDQVDDREQQELSLSERRRIDAQLNERDRLLRNVAYIDDEDEEQEGAAQLDEMGLPVQRRRRRRQYEDLENSDDDLLSDMDIDPLREELTLESLSNVKANSYSEWITQPNVSRTIARELKSFLLEYTDETGRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKNNYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYARTKIYPKLHQMDMDKVSRVYADLRRESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRAIKVVVDSFVDAQKVSVRRQLRRSFAIYTLGH

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 9 Entity 9 polymer

Description description	DNA replication licensing factor MCM3
Molecular weight formula_weight	107653.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQDDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAYFIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLVSVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNKLTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKSLGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIFDILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINPEEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYVQYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKTVNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSGSPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQLGLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTISTGRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNNLMVADDKVWRV

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 10 Entity 10 polymer

Description description	DNA replication licensing factor MCM4
Molecular weight formula_weight	105138.4 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MSQQSSSPTKEDNNSSSPVVPNPDSVPPQLSSPALFYSSSSSQGDIYGRNNSQNLSQGEGNIRAAIGSSPLNFPSSSQRQNSDVFQSQGRQGRIRSSASASGRSRYHSDLRSDRALPTSSSSLGRNGQNRVHMRRNDIHTSDLSSPRRIVDFDTRSGVNTLDTSSSSAPPSEASEPLRIIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTDEELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMVSLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAKEHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVIVLGEGVRRSVRLNNRV

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 11 Entity 11 polymer

Description description	Minichromosome maintenance protein 5
Molecular weight formula_weight	86505.7 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSFDRPEIYSAPVLQGESPNDDDNTEIIKSFKNFILEFRLDSQFIYRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGGSKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMKRYITYCRLKCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGLNQASGTSLSEIRRFEQELKRRLPIGWSTSYQTLRREFVDTHRFSQLALDKALYALEKHETIQLRHQGQNIYRSGV

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 12 Entity 12 polymer

Description description	DNA replication licensing factor MCM6
Molecular weight formula_weight	113110.2 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGPFVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLEDFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPFLQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGNGTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSSTLDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRETELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKELRKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVDDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKKKTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRLAFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 13 Entity 13 polymer

Description description	DNA replication licensing factor MCM7
Molecular weight formula_weight	95049.9 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MSAALPSIQLPVDYNNLFNEITDFLVTFKQDTLSSDATRNENEDENLDAENIEQHLLEKGPKYMAMLQKVANRELNSVIIDLDDILQYQNEKFLQGTQADDLVSAIQQNANHFTELFCRAIDNNMPLPTKEIDYKDDVLDVILNQRRLRNERMLSDRTNEIRSENLMDTTMDPPSSMNDALREVVEDETELFPPNLTRRYFLYFKPLSQNCARRYRKKAISSKPLSVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSECTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPYTGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVMELITSGDVYNRLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHMHNKQPDLDFTPVEPSKMREYIAYAKTKRPVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQETNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVRLRGFTMLQLSNCIQEYSYLNVWHLINEGNTLKFVDDGTMDTDQEDSLVSTPKLAPQTTASANVSAQDSDIDLQDA

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 14 Entity 14 polymer

Description description	Topoisomerase 1-associated factor 1
Molecular weight formula_weight	141296.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSADLQQGTTNAADFSLTVLRARIALLATAIGGPDYTSQIDPPPYKLGDDCLACLKDLKRWFKLVDDQQKRWDVAMAVAEYRILTDDLLPILIDWENKCSLAAKLAKNNPDHEEFRNKAYYDKIALNCLQLLVLMTWPLIVTEQSSSNQITLYGELKKHQLVYKKTILSMESGKVLRAAIRLALDVIKIDRLSRTPRDNMVLKLVLNFFRNVIAIEPGEFTINTKKSMPKKGITSIDTLPPNVSMDDISLNTVISSFHKNKVFGFLLTLTSSLSKEFDQDFINIPLLEIMFYFTKDVNQELLFPRQFETGTHSKVVNKNESSSANNIVTSAGFELSKLLQKEHQMRKNVIKHTSARHSRFGGLLSIQTPDKTRLTVSGSQALVDEKIALQKLDDSKKWNKRIIKKHQSVAAEGLPNSLLNSQTGKAIFFTESNGKHFKEFINNFIDSGFNILLHSVTNYFTTEQDRMVTLEQVEYLLFFAWFVKYQLLRSKIDNSADIKQVSEALKEVTFILVSSLLRSAYDLKNWTVTHAGMIAFNELLNLVSRTKAAQEEDSTDIEFIVSRLFSDERIQLLSNLPKIGSKYSLQFMKSCIELTHSVLKVLEQYSDDKTLVIEGKSRRQKKFNISEGDITKLIEEENVDRDEALDILTSSLRSIEVNFQKVQANYMTEPVIETYINFLERFRELEDDSIKKVFSFFHRVFVQAKEQALLFRFDLIILLREMLSPDGLDRMSRSRKYVSQFSDYFLARLKKRLKKSPAWFVGLLFPPLHNSEVGFYQRYGEYNVLNNESMYAAPASQFKPIPDEEALPPSILLDMKYGVLVSTLLDDGKTELLDQLLKHITHTLDIFKSWLTVNVNAGKETVNPPNEYFTLTGVLNNDPIFKDKDYRALLLLIGYSIPRKINEPCFLPGTVEVSDLTVSCELVKKYLSTPFETPNGLPSSSYLLRVRSEKDSFSHNEQDGWEGDDDYDYNDPYIVPDDQILSKSDAAYFKDLDNNASDKLKGTKFSKGIARSKKKDKRKRRKGEAKTNLPMFGDQDDERPQTVRERHGVFSKEFISDSEDDEDLMNPIFFENETYMRWLLDKNNGQLTEDRYIQFAKFAAERMNNGGVVTGDYTSLFGGSIPSIESIRATESSSFAPDKSLISLASHVASEMSIFDVNNNNNNQLSDDDVNSESRNSLGSSQPSNSQNMFQSEVYSRKESTKRSLEASAADESDEDEEAIRLFGKKSRVVLSQGDSDD

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 15 Entity 15 polymer

Description description	Chromosome segregation in meiosis protein 3
Molecular weight formula_weight	10939.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

RRPQVKLTAEKLLSDKGLPYVLKNAHKRIRISSKKNSYDNLSNIIQFYQLWAHELFPKAKFKDFMKICQTVGKTDPVLREYRVSLFRDEMGM

Source Source

Source organism organism	Saccharomyces cerevisiae W303
NCBI taxonomy ID ncbi_taxonomy_id	580240
Host organism host_organism	Saccharomyces cerevisiae W303

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 18 Entity 18 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 19 Entity 19 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	40714

Cryo-EM structure of yeast CMG helicase stalled at G4-containing DNA template, state 2

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication complex GINS protein PSF1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein PSF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein PSF3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein SLD5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cell division control protein 45

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Minichromosome maintenance protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer