9e2z

Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication licensing factor MCM2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 2； PDBConstruct 1–904； UniProt 1–904

Isoform 2 of DNA replication licensing factor MCM3

Homo sapiens

UniProt P25205

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM3_HUMAN
Isoform	P25205-2
PDB entities	2
Chains and sequence ranges	Author chain 3； PDBConstruct 1–853； UniProt 1–853

DNA replication licensing factor MCM4

Homo sapiens

UniProt P33991

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM4_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 21–883； UniProt 1–863

DNA replication licensing factor MCM5

Homo sapiens

UniProt P33992

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 5； PDBConstruct 1–734； UniProt 1–734

DNA replication licensing factor MCM6

Homo sapiens

UniProt Q14566

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM6_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 6； PDBConstruct 1–821； UniProt 1–821

DNA replication licensing factor MCM7

Homo sapiens

UniProt P33993

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCM7_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 7； PDBConstruct 1–719； UniProt 1–719

DNA replication complex GINS protein PSF1

Homo sapiens

UniProt Q14691

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSF1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–196； UniProt 1–196

DNA replication complex GINS protein PSF2

Homo sapiens

UniProt Q9Y248

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSF2_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–185； UniProt 1–185

DNA replication complex GINS protein PSF3

Homo sapiens

UniProt Q9BRX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSF3_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–216； UniProt 1–216

DNA replication complex GINS protein SLD5

Homo sapiens

UniProt Q9BRT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） Cell division control protein 45 homolog × 1 （O75419） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SLD5_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–223； UniProt 1–223

Cell division control protein 45 homolog

Homo sapiens

UniProt O75419

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 11 DNA 2	DNA replication licensing factor MCM2 × 1 （P49736） Isoform 2 of DNA replication licensing factor MCM3 × 1 （P25205） DNA replication licensing factor MCM4 × 1 （P33991） DNA replication licensing factor MCM5 × 1 （P33992） DNA replication licensing factor MCM6 × 1 （Q14566） DNA replication licensing factor MCM7 × 1 （P33993） DNA replication complex GINS protein PSF1 × 1 （Q14691） DNA replication complex GINS protein PSF2 × 1 （Q9Y248） DNA replication complex GINS protein PSF3 × 1 （Q9BRX5） DNA replication complex GINS protein SLD5 × 1 （Q9BRT9） Leading strand DNA template × 1 Lagging strand DNA template × 1 ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 6 ADENOSINE-5'-TRIPHOSPHATE × 5 ZINC ION × 4 POTASSIUM ION × 2 water × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC45_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain E； PDBConstruct 1–566； UniProt 1–566

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9e2z
Deposition date deposition_date	2024-10-23
Last revision last_revision	2025-03-26
Structure title title	Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template
Keywords keywords	helicase, DNA replication, cell division, fork stalling, translocation, REPLICATION, REPLICATION-DNA complex; REPLICATION/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9e2z__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9e2z__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9e2z__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.17 Å
Rg (electron density)	56.08 Å
Total Rg	56.09 Å
Atom count	81374
Residues	5025
Excluded volume	725820 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9e2z__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	DNA replication licensing factor MCM2
Molecular weight formula_weight	102034.1 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2
Atom count atom_count	81491

MAESSESFTMASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLGRMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMAGPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCNKCNFVLGPFCQSQNQEVKPGSCPECQSAGPFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Isoform 2 of DNA replication licensing factor MCM3
Molecular weight formula_weight	96043.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MLPRSPPLPRGNLWWREEFGSFRAGVESSWEPPRDFGGGSSLAAGMAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	DNA replication licensing factor MCM4
Molecular weight formula_weight	99119.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MHHHHHHHHENLYFQGSSATMSSPASTPSRRGSRRGRATPAQTPRSEDARSSPSQRRRGEDSTSTGELQPMPTSPGVDLQSPAAQDVLFSSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDITEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGKFRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMPRLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVRLL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	DNA replication licensing factor MCM5
Molecular weight formula_weight	82406.6 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLTNIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGGSRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLHVSALTQTQAVEGEIDLAKLKKFIAYCRVKCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGVEGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGEIQHRMQRKVLYRLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	DNA replication licensing factor MCM6
Molecular weight formula_weight	93010.3 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MDLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDFYVAFQDLPTRHKIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICRNPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTTGEGTSLRGDINVCIVGDPSTAKSQFLKHVEEFSPRAVYTSGKASSAAGLTAAVVRDEESHEFVIEAGALMLADNGVCCIDEFDKMDVRDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPISGHYDRSKSLKQNINLSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHSRIEESIDRVYSLDDIRRYLLFARQFKPKISKESEDFIVEQYKHLRQRDGSGVTKSSWRITVRQLESMIRLSEAMARMHCCDEVQPKHVKEAFRLLNKSIIRVETPDVNLDQEEEIQMEVDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLED

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	DNA replication licensing factor MCM7
Molecular weight formula_weight	81411.9 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	DNA replication complex GINS protein PSF1
Molecular weight formula_weight	23022.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	DNA replication complex GINS protein PSF2
Molecular weight formula_weight	25336.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSADSFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDFENLYFQGSAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	DNA replication complex GINS protein PSF3
Molecular weight formula_weight	24562.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	DNA replication complex GINS protein SLD5
Molecular weight formula_weight	26081.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKREDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESYLKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQLI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Cell division control protein 45 homolog
Molecular weight formula_weight	65651.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHRNEDEENTLSVDCTRISFEYDLRLVLYQHWSLHDSLCNTSYTAARFKLWSVHGQKRLQEFLADMGLPLKQVKQKFQAMDISLKENLREMIEESANKFGMKDMRVQTFSIHFGFKHKFLASDVVFATMSLMESPEKDGSGTDHFIQALDSLSRSNLDKLYHGLELAKKQLRATQQTIASCLCTNLVISQGPFLYCSLMEGTPDVMLFSRPASLSLLSKHLLKSFVCSTKNRRCKLLPLVMAAPLSMEHGTVTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAEDRSKFLDALISLLS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Leading strand DNA template
Molecular weight formula_weight	12582.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	F

GTGATATCTGCTTTGGGTGGGTGGGTGGGTTGAGGCAATA

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 13 Entity 13 polymer

Description description	Lagging strand DNA template
Molecular weight formula_weight	3968.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	G

AAGCAGATATCAC

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	synthetic construct

Entity 14 Entity 14 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 18 Entity 18 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	39

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	187345

Cryo-EM structure of human CMG helicase stalled at G4-containing DNA template

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA replication licensing factor MCM2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 2 of DNA replication licensing factor MCM3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication licensing factor MCM7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein PSF1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein PSF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein PSF3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA replication complex GINS protein SLD5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer